KEGG   Mus musculus (mouse): 16768
Entry
16768             CDS       T01002                                 

Symbol
Lag3, CD223, LAG-3, Ly66
Name
(RefSeq) lymphocyte-activation gene 3
  KO
K06565  lymphocyte-activation gene 3 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16768 (Lag3)
CD molecules [BR:mmu04090]
 Proteins
  16768 (Lag3)
SSDB
Motif
Pfam: Ig_2 ig Ig_3 V-set I-set Izumo-Ig Ig_6
Other DBs
NCBI-GeneID: 16768
NCBI-ProteinID: NP_032505
MGI: 106588
Ensembl: ENSMUSG00000030124
Vega: OTTMUSG00000024400
UniProt: Q61790
Position
6:complement(124881322..124888668)
AA seq 521 aa
MREDLLLGFLLLGLLWEAPVVSSGPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGG
VIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEE
RGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDW
VLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYR
DGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHLPPGVGTPSLLIAKWTPPGGGPE
LPVAGKSGNFTLHLEAVGLAQAGTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGK
LLCEVTPASGKERFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYA
AESSSGAHSARRISGDLKGGHLVLVLILGALSLFLLVAGAFGFHWWRKQLLLRRFSALEH
GIQPFPAQRKIEELERELETEMGQEPEPEPEPQLEPEPRQL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgagggaggacctgctccttggctttttgcttctgggactgctttgggaagctccagtt
gtgtcttcagggcctgggaaagagctccccgtggtgtgggcccaggagggagctcccgtc
catcttccctgcagcctcaaatcccccaacctggatcctaactttctacgaagaggaggg
gttatctggcaacatcaaccagacagtggccaacccactcccatcccggcccttgacctt
caccaggggatgccctcgcctagacaacccgcacccggtcgctacacggtgctgagcgtg
gctccaggaggcctgcgcagcgggaggcagcccctgcatccccacgtgcagctggaggag
cgcggcctccagcgcggggacttctctctgtggttgcgcccagctctgcgcaccgatgcg
ggcgagtaccacgccaccgtgcgcctcccgaaccgcgccctctcctgcagtctccgcctg
cgcgtcggccaggcctcgatgattgctagtccctcaggagtcctcaagctgtctgattgg
gtccttttgaactgctccttcagccgtcctgaccgcccagtctctgtgcactggttccag
ggccagaaccgagtgcctgtctacaactcaccgcgtcattttttagctgaaactttcctg
ttactgccccaagtcagccccctggactctgggacctggggctgtgtcctcacctacaga
gatggcttcaatgtctccatcacgtacaacctcaaggttctgggtctggagcccgtagcc
cctctgacagtgtacgctgctgaaggttctagggtggagctgccctgtcatttgccccca
ggagtggggaccccttctttgctcattgccaagtggactcctcctggaggaggtcctgag
ctccccgtggctggaaagagtggcaattttacccttcaccttgaggctgtgggtctggca
caggctgggacctacacctgtagcatccatctgcagggacagcagctcaatgccactgtc
acgttggcggtcatcacagtgactcccaaatccttcgggttacctggctcccgggggaag
ctgttgtgtgaggtaaccccggcatctggaaaggaaagatttgtgtggcgtcccctgaac
aatctgtccaggagttgcccgggccctgtgctggagattcaggaggccaggctccttgct
gagcgatggcagtgtcagctgtacgagggccagaggcttcttggagcgacagtgtacgcc
gcagagtctagctcaggcgcccacagtgctaggagaatctcaggtgaccttaaaggaggc
catctcgttctcgttctcatccttggtgccctctccctgttccttttggtggccggggcc
tttggctttcactggtggagaaaacagttgctactgagaagattttctgccttagaacat
gggattcagccatttccggctcagaggaagatagaggagctggagcgagaactggagacg
gagatgggacaggagccggagcccgagccggagccacagctggagccagagcccaggcag
ctctga

DBGET integrated database retrieval system