KEGG   Mus musculus (house mouse): 16772
Entry
16772             CDS       T01002                                 
Symbol
Lama1, AA408497, Lama
Name
(RefSeq) laminin, alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16772 (Lama1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16772 (Lama1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16772 (Lama1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16772 (Lama1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16772 (Lama1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16772 (Lama1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16772 (Lama1)
   05145 Toxoplasmosis
    16772 (Lama1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16772 (Lama1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16772 (Lama1)
   05414 Dilated cardiomyopathy
    16772 (Lama1)
   05416 Viral myocarditis
    16772 (Lama1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3
Other DBs
NCBI-GeneID: 16772
NCBI-ProteinID: NP_032506
MGI: 99892
Ensembl: ENSMUSG00000032796
UniProt: P19137
Structure
Position
17:68004129..68129640
AA seq 3083 aa
MRGSGTGAALLVLLASVLWVTVRSQQRGLFPAILNLATNAHISANATCGEKGPEMFCKLV
EHVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTVTLDL
RQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGPPT
YRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRT
LNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCE
HNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAG
QYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDD
RHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNEDPCIEPCLC
KKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDL
MSTNKIRSQQDVLGGHRQISINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSY
DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRRE
IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQ
GYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECDIHGICSVCTHNTTGDHCEQCL
PGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCAD
GYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDA
VTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNC
SVEGSVSDNCTEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGE
CLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQS
CHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQ
AGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEG
VHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSN
YEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSV
LSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSC
QDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCEL
CASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSA
GYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDC
VSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKI
RAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITE
KVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI
QKRFQKPQEKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQ
EKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVD
DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLT
EEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLDELK
NLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALS
LRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEE
NLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDN
LLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMG
SLSVKEASAAENPPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILF
STFSPNGLLFYLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDTSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLAT
FATKNSSGILLVALGKDAEEAGGAQAHVPFFSIMLLEGRIEVHVNSGDGTSLRKALLHAP
TGSYSDGQEHSISLVRNRRVITIQVDENSPVEMKLGPLTEGKTIDISNLYIGGLPEDKAT
PMLKMRTSFHGCIKNVVLDAQLLDFTHATGSEQVELDTCLLAEEPMQSLHREHGELPPEP
PTLPQPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLNQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTTSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNSVRAESPHTHSTSADTNDPIYVGGYPAHIKQNCLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP
NT seq 9252 nt   +upstreamnt  +downstreamnt
atgcgcggcagcggcacgggagccgcgctcctggtgctcctggcctcggtgctctgggtc
accgtgcggagccagcagagaggcttgttccctgccattctcaacctggccaccaatgcc
cacatcagcgccaatgctacctgtggagagaaggggcctgagatgttctgcaaactcgtg
gagcacgtgccgggccggcctgttcgacacgcccaatgccgggtctgtgacggtaacagt
acgaatcctagagagcgccatccgatatcacacgcaatcgatggcaccaacaactggtgg
cagagccccagtattcagaatgggagagagtatcactgggtcactgtcaccctggactta
cggcaggtctttcaagttgcatacatcatcattaaagctgccaatgcccctcggcctgga
aactggattttggagcgctccgtggatggcgtcaagttcaaaccctggcagtactatgcc
gtcagcgatacagagtgtttgacccgctacaaaataactccacggcggggacctcccact
tacagagcagacaacgaagtcatctgcacctcgtattattcaaagctggtgccacttgaa
catggagagattcacacatcactcatcaatggcagacccagcgctgacgacccctcaccc
cagttgctggaattcacctcagcacggtacattcgccttcgtctgcagcgcatcagaaca
ctcaacgcagacctcatgacccttagccatcgggacctcagagaccttgaccccattgtc
acaagacgttattactattcgataaaagacatttccgttggaggcatgtgcatttgctac
ggccatgccagcagctgcccgtgggatgaagaagcaaagcaactacagtgtcagtgtgaa
cacaatacgtgtggcgagagctgcgacaggtgctgtcctggctaccatcagcagccctgg
aggcccggaaccatttcctccggcaacgagtgtgaggaatgcaactgtcacaacaaagcc
aaagattgttactatgacagcagtgttgcaaaggagaggagaagcctgaacactgccggg
cagtacagtggaggaggggtttgtgtcaactgctcgcagaataccacagggatcaactgt
gaaacctgtatcgaccagtattacagacctcacaaggtatctccttatgatgaccaccct
tgccgtccctgtaactgtgaccctgtggggtctctgagttctgtctgtatcaaggatgac
cgccatgccgatttagccaatggaaagtggccaggtcagtgtccatgtaggaaaggttat
gctggagataaatgtgaccgctgccagtttggctaccggggtttcccaaattgcatcccc
tgtgactgcaggactgtcggcagcctgaatgaggatccatgcatagagccgtgtctttgt
aagaaaaatgttgagggtaagaactgtgatcgctgcaagccaggattctacaacttgaag
gaacgaaaccccgagggctgctccgagtgcttctgcttcggtgtctctggtgtctgtgac
agcctcacgtggtccattagtcaggtgaccaatatgtcagggtggctggtcactgacttg
atgagcacaaataagatccggtcccagcaagatgtcctgggtgggcaccgtcagatcagc
atcaacaacacggcggtcatgcagaggctgacttccacttactactgggcagctcctgag
gcctacctcggaaacaagctgacagcatttggcggtttcctgaaatacactgtgtcttac
gacattccagtggagacggtggacagtgacctcatgtctcatgctgacatcatcatcaag
gggaatgggctcaccataagcacaagagctgagggcctgtccttgcaaccctatgaggaa
tacttcaacgtggttagacttgtgcctgagaacttccgggactttgataccagaagggag
attgaccgtgaccagctgatgactgtcctggccaatgtgacacatctcttgatcagagcc
aattataattctgctaaaatggcgctctataggctggattctgtctctctggacatagca
agccctaatgctatagacttggcagtggctgctgatgtggaacactgtgaatgtccccaa
ggctacacggggacctcctgtgaggcctgcctccctggctattatcgagtagacgggata
ctctttggaggaatctgtcagccctgcgagtgccacgggcatgcatccgagtgtgacatt
catggaatttgctctgtgtgtacacacaacaccacgggggatcactgtgagcagtgcctg
cctggcttctatgggacaccttcacgtgggaccccaggagactgccagccttgtgcctgc
cctctctccattgactctaacaatttcagccctacctgccacctcactgatggagaggaa
gtggtttgtgaccagtgtgccccgggttactcaggatcctggtgtgagagatgtgcagat
ggttactatggaaacccaaccgtgccagggggaacctgtgtaccatgcaactgcagtggc
aatgttgatcccttggaggctggccactgtgactctgtcacaggggaatgcctgaagtgc
ttatggaacacagacggtgcccattgtgagaggtgtgcagatggcttctatggagatgcc
gtgactgccaaaaactgccgagcctgtgactgccacgagaatggctccctttctggcatc
tgccatctggagactggactgtgtgactgcaaacctcacgtgacaggacagcagtgtgac
cagtgcctgtctggctactacgggttggacacggggcttggctgtgtgccctgtaactgc
agtgtggaaggctctgtatctgacaactgcacggaggaaggacagtgtcactgtggacca
ggtgtctctgggaaacagtgtgacaggtgttcacacggtttctatgcattccaggatggc
ggctgcacaccctgtgactgtgctcatacccagaataactgtgaccccgcctctggagag
tgtctctgcccgcctcacacgcaggggctgaagtgtgaggagtgtgaagaggcatactgg
ggtctggacccggagcaggggtgccaggcttgcaattgcagtgctgtgggctccacgagt
gcccagtgtgatgttctctctggccactgcccctgcaaaaaagggtttggtgggcagagc
tgccatcagtgttccctaggctacagaagttttcctgactgtgtcccctgtggctgtgac
ctgagggggacactgcctgacacctgcgacctggaacagggtctctgcagctgctcagag
gacggtggtacctgctcctgcaaggagaatgccgtgggcccccagtgcagtaagtgccaa
gccggcacctttgccttgcgaggggacaaccctcaaggctgcagcccctgcttctgcttc
ggtctgtcgcagctctgctcagagttggagggttacgtgaggactctgataactctagcc
tccgatcagcccctcctgcatgtggtttcacagagcaacctcaagggcacaatcgaaggc
gtgcatttccagcctcctgacaccttgctggacgcagaggctgtccgccagcatatctat
gcagagccattttactggcggctaccaaagcagttccagggagaccagctcttggcttat
ggtgggaaactccagtacagtgtggctttctactctacacttggcaccggaacatccaat
tatgagcctcaagtcctcatcaaaggaggtcgggccaggaagcacgtcatttatatggat
gccccagcgcctgagaatggagtgagacaggattacgaagtgcggatgaaagaggaattc
tggaaatattttaactccgtgtctgagaaacatgtcacacactctgattttatgtctgtt
ctcagcaatattgactacatcctcatcaaagcatcatacggccagggactgcagcagagc
agaattgccaacatttccatggaggttggccggaaagctgtcgagctgcccgctgagggc
gaggcggcattgctgttggagctctgtgtctgtcctcctggcaccgcaggacactcctgt
caggactgtgctcctgggtactacagagaaaagctcccagaaagtggtggcaggggaccc
cgccctctgctggctccttgtgtgccctgcaattgcaacaaccacagtgatgtctgtgac
cccgaaactggaaagtgcctgagctgcagggaccacacatccggggaccactgtgagctg
tgtgcttctggctactatgggaaggtgactggactgcctggagactgtaccccgtgcacc
tgtcctcatcaccctcctttcagtttcagccccacttgtgtcgtggaaggtgacagtgat
ttccggtgcaatgcctgcctccccggctatgaaggacagtactgtgaaaggtgctctgca
ggctatcacggcaaccctcgagcagcaggtggtagctgccaaacgtgtgattgcaacccc
caaggctctgtccacagtgactgtgaccgtgcatccgggcagtgtgtctgcaagccagga
gctacagggctccactgtgagaaatgcctgccgagacacatcctgatggagagcgactgt
gtttcctgtgatgatgactgtgtgggtcctttgctgaacgacctggattctgttggtgat
gccgttctgtctctgaacctcacgggcgtttcccctgctccctatggaatcctggaaaat
ctggaaaatacaactaaatatttccagaggtatttaataaaggaaaatgccaagaagatt
cgagcagagatccagctcgaagggattgcagagcaaacagaaaatctgcaaaaggagctc
accagagtgttagcacgccatcagaaggtgaacgctgaaatggaaagaacttccaatggg
actcaagccctggccacgttcattgagcagctacatgcaaacatcaaagaaatcacagaa
aaggtggcaacgttgaaccagacggcgcgtaaagatttccagccacccgtgtctgccctt
cagagcatgcaccagaacatttcgtctctgctgggactcatcaaggaaaggaatttcaca
gagatgcagcagaatgctacccttgagctcaaggctgctaaagacttattgtcacggatt
cagaaaaggtttcagaagcctcaggaaaagttgaaggcattgaaggaggccaacagcctc
ctttccaaccacagtgaaaaactgcaggctgctgaggagctccttaaggaagctggaagc
aagacccaggagagcaacctcctgctgctccttgtcaaggccaacctgaaagaattccag
gagaaaaagctgcgtgttcaagaagaacaaaatgtgacctcagagctcattgccaagggt
agagaatgggtggatgctgccgggactcacacagctgctgcacaagacaccctaacacag
ctggagcatcaccgagatgaactccttctgtgggccagaaaaatcaggagccacgtagat
gacctcgtcatgcagatgtccaaacgaagagcccgtgacctggtccacagggcagagcag
catgcctctgagctgcagagcagggcaggagctttggacagagaccttgaaaatgttaga
aacgtgtctttgaatgccaccagtgcggcacacgtccacagcaacatccagacactgaca
gaggaagctgagatgctggctgctgatgctcacaagacggcgaataagacagacttgatc
tccgaatccctggcttctcgggggaaagcagtccttcagcgctcgtcccggtttctaaag
gaaagtgtcagtaccaggaggaagcagcaaggcattacgatgaagctggatgagttgaaa
aacttaacaagtcaatttcaggagagcatggataacattatgaagcaggccaacgactcc
cttgcgatgcttagagaaagccctggaggtatgagagagaagggcaggaaagccagagag
ctggcggcagcagccaacgagagtgcggtgaagacactggaggatgtgctggctttgagc
ctgagggtcttcaatacatcagaggacctgtccagagtgaatgccacagtccaggagaca
aacgaccttctgcataactccacgatgaccactctgttggctggaagaaaaatgaaagac
atggaaatgcaagccaaccttttattggatcgattgaaacctttgaaaaccctggaggag
aacctgagcagaaacctgtcggagatcaagctgctgatcagccgggcccggaaacaagtg
gcgtcgatcaaagtcgccgtgtctgcagacagagactgcatccgcgcctatcagcctcag
acttcatctaccaattacaacaccttgatcctgaacgtgaagacgcaggagcccgacaac
ctcctcttctacctcggcagcagcagcagttctgactttctcgcagtggagatgcggcgg
gggaaggtcgcctttctctgggacctgggctccgggtccacaaggttggaattcccagag
gtctccatcaataacaacagatggcacagcatctacataaccaggtttggaaacatgggg
tccctgagtgtaaaggaagcaagcgctgccgagaacccaccggtcaggacaagcaaatct
cctggaccgtcgaaggttctggacataaacaattcaacgctgatgtttgttggagggctc
ggaggtcagatcaagaaatccccggctgtgaaggttactcattttaagggctgcatggga
gaggccttcttgaatggcaaatcgattggcctgtggaattacatcgagagagaggggaag
tgcaatggctgctttggaagctcccagaacgaagattcctccttccatttcgatggaagc
gggtacgccatggtggagaagacgctccggcccaccgtgacgcagatagtaattctcttc
agcaccttctccccgaatggccttcttttctacctggcttcaaacggcaccaaggacttc
ctatccatcgagctggtccgtggcagggtcaaagtgatggtggacctagggtcaggaccc
ctcactcttatgacagacaggcggtataacaacggaacctggtataaaatcgccttccag
cggaaccggaagcaaggactgctagctgtcttcgatgcatatgacaccagtgacaaggag
acaaagcaaggagagactccaggagccgcttccgacctcaatcggctggagaaagacctg
atttacgtgggtggattgcctcattctaaggctgtgaggaaaggggtcagcagcagaagc
tatgtgggctgtatcaagaacctagagatatccaggtccacctttgatttgctgagaaat
tcctacggagtgagaaaaggctgcgcactggagcctatccagagtgtgagtttcctgaga
ggcggctatgtggagatgccacccaagtctctctcacctgagtcatccctgctggccaca
ttcgccaccaagaacagcagcggaatcctcctggttgccctgggcaaggatgcggaggag
gctggtggggctcaggcacatgtgcccttcttttccatcatgctgcttgagggacgaatt
gaagtgcatgtcaactctggggacgggaccagtctgaggaaggccctcctgcatgccccc
accggctcctacagtgatggacaggaacactccatctccctggttaggaatcggagagtt
atcaccatacaagtggatgagaacagtcccgtagaaatgaagttgggtccattaacagaa
ggaaagacgatcgacatatccaacctgtacatagggggacttccggaggacaaggcgacc
ccgatgctcaagatgcggacttcgttccatgggtgtattaaaaacgtggtccttgacgct
caacttttggacttcacccatgcgactggctctgagcaagtagagctggacacatgcttg
ctggcagaagagcccatgcagagtctgcacagagaacacggggaactccctccggagccc
ccaactctaccacagcctgaactgtgcgcagtagacacggctccggggtatgtggcaggt
gctcaccagtttggcctctcgcagaacagccacttggtgctccctctgaatcagtctgat
gtccggaagaggctccaggtgcagctgagcattcggacatttgcctccagtggcctcatt
tactatgtggctcatcagaaccaaatggactacgccacgctccagctccaagagggccgc
ctgcacttcatgtttgatctcggcaagggccggaccaaggtctcccaccctgccctgctc
agtgatggcaagtggcacacagtcaagacagaatacattaaaaggaaggcgttcatgact
gttgacggccaagagtcccccagtgtgactgtggtgggcaatgcaaccacgctggatgtg
gaaaggaaactgtacctcggaggccttcccagccactacagggccaggaacatcgggact
atcacccacagcatccctgcctgcattggggaaatcatggttaatggccaacagctggat
aaagacaggcccttgtctgcctctgctgtggacaggtgctatgtcgtggctcaggaagga
actttctttgaaggaagcggatatgcagctcttgtcaaggaaggttacaaagttcgattg
gatttaaatatcacactggagttccgtactacctctaagaatggcgtcctcctgggaatc
agcagtgccaaagtggatgccattggcctagagattgtagatggcaaggtcttatttcac
gtcaacaacggtgccggaaggataacagccacctaccagcccagagccgccagagctctc
tgtgatggcaagtggcacacactccaagcccacaaaagcaagcaccgcatcgtcctgact
gtggacgggaattccgttagggctgaaagcccccacacccattccacctcggcagacacc
aacgatcccatttatgtgggtggctatcctgcccacatcaaacagaactgcctgagcagc
cgggcctcattccggggctgtgtgaggaacctcaggctgagcaggggctcacaagtgcag
tccttggacctgagccgagcctttgacctacaaggagtcttccctcattcctgccccggg
cctgagccctaa

DBGET integrated database retrieval system