KEGG   Mus musculus (mouse): 16772
Entry
16772             CDS       T01002                                 

Gene name
Lama1, AA408497, L, Lama
Definition
(RefSeq) laminin, alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16772 (Lama1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16772 (Lama1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16772 (Lama1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16772 (Lama1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16772 (Lama1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16772 (Lama1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16772 (Lama1)
   05145 Toxoplasmosis
    16772 (Lama1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16772 (Lama1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16772 (Lama1)
   05414 Dilated cardiomyopathy
    16772 (Lama1)
   05416 Viral myocarditis
    16772 (Lama1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3 DUF2520 Hepar_II_III
Other DBs
NCBI-GeneID: 16772
NCBI-ProteinID: NP_032506
MGI: 99892
Ensembl: ENSMUSG00000032796
UniProt: P19137
Structure
PDB: 
5MC9 2JD4

Position
17 E1.1; 17 38.8 cM
AA seq 3083 aa
MRGSGTGAALLVLLASVLWVTVRSQQRGLFPAILNLATNAHISANATCGEKGPEMFCKLV
EHVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTVTLDL
RQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGPPT
YRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRT
LNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCE
HNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAG
QYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDD
RHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNEDPCIEPCLC
KKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDL
MSTNKIRSQQDVLGGHRQISINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSY
DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRRE
IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQ
GYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECDIHGICSVCTHNTTGDHCEQCL
PGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCAD
GYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDA
VTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNC
SVEGSVSDNCTEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGE
CLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQS
CHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQ
AGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEG
VHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSN
YEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSV
LSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSC
QDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCEL
CASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSA
GYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDC
VSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKI
RAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITE
KVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI
QKRFQKPQEKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQ
EKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVD
DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLT
EEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLDELK
NLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALS
LRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEE
NLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDN
LLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMG
SLSVKEASAAENPPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILF
STFSPNGLLFYLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDTSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLAT
FATKNSSGILLVALGKDAEEAGGAQAHVPFFSIMLLEGRIEVHVNSGDGTSLRKALLHAP
TGSYSDGQEHSISLVRNRRVITIQVDENSPVEMKLGPLTEGKTIDISNLYIGGLPEDKAT
PMLKMRTSFHGCIKNVVLDAQLLDFTHATGSEQVELDTCLLAEEPMQSLHREHGELPPEP
PTLPQPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLNQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTTSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNSVRAESPHTHSTSADTNDPIYVGGYPAHIKQNCLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP
NT seq 9252 nt   +upstreamnt  +downstreamnt
atgcgcggcagcggcacgggagccgcgctcctggtgctcctggcctcggtgctctgggtc
accgtgcggagccagcagagaggcttgttccctgccattctcaacctggccaccaatgcc
cacatcagcgccaatgctacctgtggagagaaggggcctgagatgttctgcaaactcgtg
gagcacgtgccgggccggcctgttcgacacgcccaatgccgggtctgtgacggtaacagt
acgaatcctagagagcgccatccgatatcacacgcaatcgatggcaccaacaactggtgg
cagagccccagtattcagaatgggagagagtatcactgggtcactgtcaccctggactta
cggcaggtctttcaagttgcatacatcatcattaaagctgccaatgcccctcggcctgga
aactggattttggagcgctccgtggatggcgtcaagttcaaaccctggcagtactatgcc
gtcagcgatacagagtgtttgacccgctacaaaataactccacggcggggacctcccact
tacagagcagacaacgaagtcatctgcacctcgtattattcaaagctggtgccacttgaa
catggagagattcacacatcactcatcaatggcagacccagcgctgacgacccctcaccc
cagttgctggaattcacctcagcacggtacattcgccttcgtctgcagcgcatcagaaca
ctcaacgcagacctcatgacccttagccatcgggacctcagagaccttgaccccattgtc
acaagacgttattactattcgataaaagacatttccgttggaggcatgtgcatttgctac
ggccatgccagcagctgcccgtgggatgaagaagcaaagcaactacagtgtcagtgtgaa
cacaatacgtgtggcgagagctgcgacaggtgctgtcctggctaccatcagcagccctgg
aggcccggaaccatttcctccggcaacgagtgtgaggaatgcaactgtcacaacaaagcc
aaagattgttactatgacagcagtgttgcaaaggagaggagaagcctgaacactgccggg
cagtacagtggaggaggggtttgtgtcaactgctcgcagaataccacagggatcaactgt
gaaacctgtatcgaccagtattacagacctcacaaggtatctccttatgatgaccaccct
tgccgtccctgtaactgtgaccctgtggggtctctgagttctgtctgtatcaaggatgac
cgccatgccgatttagccaatggaaagtggccaggtcagtgtccatgtaggaaaggttat
gctggagataaatgtgaccgctgccagtttggctaccggggtttcccaaattgcatcccc
tgtgactgcaggactgtcggcagcctgaatgaggatccatgcatagagccgtgtctttgt
aagaaaaatgttgagggtaagaactgtgatcgctgcaagccaggattctacaacttgaag
gaacgaaaccccgagggctgctccgagtgcttctgcttcggtgtctctggtgtctgtgac
agcctcacgtggtccattagtcaggtgaccaatatgtcagggtggctggtcactgacttg
atgagcacaaataagatccggtcccagcaagatgtcctgggtgggcaccgtcagatcagc
atcaacaacacggcggtcatgcagaggctgacttccacttactactgggcagctcctgag
gcctacctcggaaacaagctgacagcatttggcggtttcctgaaatacactgtgtcttac
gacattccagtggagacggtggacagtgacctcatgtctcatgctgacatcatcatcaag
gggaatgggctcaccataagcacaagagctgagggcctgtccttgcaaccctatgaggaa
tacttcaacgtggttagacttgtgcctgagaacttccgggactttgataccagaagggag
attgaccgtgaccagctgatgactgtcctggccaatgtgacacatctcttgatcagagcc
aattataattctgctaaaatggcgctctataggctggattctgtctctctggacatagca
agccctaatgctatagacttggcagtggctgctgatgtggaacactgtgaatgtccccaa
ggctacacggggacctcctgtgaggcctgcctccctggctattatcgagtagacgggata
ctctttggaggaatctgtcagccctgcgagtgccacgggcatgcatccgagtgtgacatt
catggaatttgctctgtgtgtacacacaacaccacgggggatcactgtgagcagtgcctg
cctggcttctatgggacaccttcacgtgggaccccaggagactgccagccttgtgcctgc
cctctctccattgactctaacaatttcagccctacctgccacctcactgatggagaggaa
gtggtttgtgaccagtgtgccccgggttactcaggatcctggtgtgagagatgtgcagat
ggttactatggaaacccaaccgtgccagggggaacctgtgtaccatgcaactgcagtggc
aatgttgatcccttggaggctggccactgtgactctgtcacaggggaatgcctgaagtgc
ttatggaacacagacggtgcccattgtgagaggtgtgcagatggcttctatggagatgcc
gtgactgccaaaaactgccgagcctgtgactgccacgagaatggctccctttctggcatc
tgccatctggagactggactgtgtgactgcaaacctcacgtgacaggacagcagtgtgac
cagtgcctgtctggctactacgggttggacacggggcttggctgtgtgccctgtaactgc
agtgtggaaggctctgtatctgacaactgcacggaggaaggacagtgtcactgtggacca
ggtgtctctgggaaacagtgtgacaggtgttcacacggtttctatgcattccaggatggc
ggctgcacaccctgtgactgtgctcatacccagaataactgtgaccccgcctctggagag
tgtctctgcccgcctcacacgcaggggctgaagtgtgaggagtgtgaagaggcatactgg
ggtctggacccggagcaggggtgccaggcttgcaattgcagtgctgtgggctccacgagt
gcccagtgtgatgttctctctggccactgcccctgcaaaaaagggtttggtgggcagagc
tgccatcagtgttccctaggctacagaagttttcctgactgtgtcccctgtggctgtgac
ctgagggggacactgcctgacacctgcgacctggaacagggtctctgcagctgctcagag
gacggtggtacctgctcctgcaaggagaatgccgtgggcccccagtgcagtaagtgccaa
gccggcacctttgccttgcgaggggacaaccctcaaggctgcagcccctgcttctgcttc
ggtctgtcgcagctctgctcagagttggagggttacgtgaggactctgataactctagcc
tccgatcagcccctcctgcatgtggtttcacagagcaacctcaagggcacaatcgaaggc
gtgcatttccagcctcctgacaccttgctggacgcagaggctgtccgccagcatatctat
gcagagccattttactggcggctaccaaagcagttccagggagaccagctcttggcttat
ggtgggaaactccagtacagtgtggctttctactctacacttggcaccggaacatccaat
tatgagcctcaagtcctcatcaaaggaggtcgggccaggaagcacgtcatttatatggat
gccccagcgcctgagaatggagtgagacaggattacgaagtgcggatgaaagaggaattc
tggaaatattttaactccgtgtctgagaaacatgtcacacactctgattttatgtctgtt
ctcagcaatattgactacatcctcatcaaagcatcatacggccagggactgcagcagagc
agaattgccaacatttccatggaggttggccggaaagctgtcgagctgcccgctgagggc
gaggcggcattgctgttggagctctgtgtctgtcctcctggcaccgcaggacactcctgt
caggactgtgctcctgggtactacagagaaaagctcccagaaagtggtggcaggggaccc
cgccctctgctggctccttgtgtgccctgcaattgcaacaaccacagtgatgtctgtgac
cccgaaactggaaagtgcctgagctgcagggaccacacatccggggaccactgtgagctg
tgtgcttctggctactatgggaaggtgactggactgcctggagactgtaccccgtgcacc
tgtcctcatcaccctcctttcagtttcagccccacttgtgtcgtggaaggtgacagtgat
ttccggtgcaatgcctgcctccccggctatgaaggacagtactgtgaaaggtgctctgca
ggctatcacggcaaccctcgagcagcaggtggtagctgccaaacgtgtgattgcaacccc
caaggctctgtccacagtgactgtgaccgtgcatccgggcagtgtgtctgcaagccagga
gctacagggctccactgtgagaaatgcctgccgagacacatcctgatggagagcgactgt
gtttcctgtgatgatgactgtgtgggtcctttgctgaacgacctggattctgttggtgat
gccgttctgtctctgaacctcacgggcgtttcccctgctccctatggaatcctggaaaat
ctggaaaatacaactaaatatttccagaggtatttaataaaggaaaatgccaagaagatt
cgagcagagatccagctcgaagggattgcagagcaaacagaaaatctgcaaaaggagctc
accagagtgttagcacgccatcagaaggtgaacgctgaaatggaaagaacttccaatggg
actcaagccctggccacgttcattgagcagctacatgcaaacatcaaagaaatcacagaa
aaggtggcaacgttgaaccagacggcgcgtaaagatttccagccacccgtgtctgccctt
cagagcatgcaccagaacatttcgtctctgctgggactcatcaaggaaaggaatttcaca
gagatgcagcagaatgctacccttgagctcaaggctgctaaagacttattgtcacggatt
cagaaaaggtttcagaagcctcaggaaaagttgaaggcattgaaggaggccaacagcctc
ctttccaaccacagtgaaaaactgcaggctgctgaggagctccttaaggaagctggaagc
aagacccaggagagcaacctcctgctgctccttgtcaaggccaacctgaaagaattccag
gagaaaaagctgcgtgttcaagaagaacaaaatgtgacctcagagctcattgccaagggt
agagaatgggtggatgctgccgggactcacacagctgctgcacaagacaccctaacacag
ctggagcatcaccgagatgaactccttctgtgggccagaaaaatcaggagccacgtagat
gacctcgtcatgcagatgtccaaacgaagagcccgtgacctggtccacagggcagagcag
catgcctctgagctgcagagcagggcaggagctttggacagagaccttgaaaatgttaga
aacgtgtctttgaatgccaccagtgcggcacacgtccacagcaacatccagacactgaca
gaggaagctgagatgctggctgctgatgctcacaagacggcgaataagacagacttgatc
tccgaatccctggcttctcgggggaaagcagtccttcagcgctcgtcccggtttctaaag
gaaagtgtcagtaccaggaggaagcagcaaggcattacgatgaagctggatgagttgaaa
aacttaacaagtcaatttcaggagagcatggataacattatgaagcaggccaacgactcc
cttgcgatgcttagagaaagccctggaggtatgagagagaagggcaggaaagccagagag
ctggcggcagcagccaacgagagtgcggtgaagacactggaggatgtgctggctttgagc
ctgagggtcttcaatacatcagaggacctgtccagagtgaatgccacagtccaggagaca
aacgaccttctgcataactccacgatgaccactctgttggctggaagaaaaatgaaagac
atggaaatgcaagccaaccttttattggatcgattgaaacctttgaaaaccctggaggag
aacctgagcagaaacctgtcggagatcaagctgctgatcagccgggcccggaaacaagtg
gcgtcgatcaaagtcgccgtgtctgcagacagagactgcatccgcgcctatcagcctcag
acttcatctaccaattacaacaccttgatcctgaacgtgaagacgcaggagcccgacaac
ctcctcttctacctcggcagcagcagcagttctgactttctcgcagtggagatgcggcgg
gggaaggtcgcctttctctgggacctgggctccgggtccacaaggttggaattcccagag
gtctccatcaataacaacagatggcacagcatctacataaccaggtttggaaacatgggg
tccctgagtgtaaaggaagcaagcgctgccgagaacccaccggtcaggacaagcaaatct
cctggaccgtcgaaggttctggacataaacaattcaacgctgatgtttgttggagggctc
ggaggtcagatcaagaaatccccggctgtgaaggttactcattttaagggctgcatggga
gaggccttcttgaatggcaaatcgattggcctgtggaattacatcgagagagaggggaag
tgcaatggctgctttggaagctcccagaacgaagattcctccttccatttcgatggaagc
gggtacgccatggtggagaagacgctccggcccaccgtgacgcagatagtaattctcttc
agcaccttctccccgaatggccttcttttctacctggcttcaaacggcaccaaggacttc
ctatccatcgagctggtccgtggcagggtcaaagtgatggtggacctagggtcaggaccc
ctcactcttatgacagacaggcggtataacaacggaacctggtataaaatcgccttccag
cggaaccggaagcaaggactgctagctgtcttcgatgcatatgacaccagtgacaaggag
acaaagcaaggagagactccaggagccgcttccgacctcaatcggctggagaaagacctg
atttacgtgggtggattgcctcattctaaggctgtgaggaaaggggtcagcagcagaagc
tatgtgggctgtatcaagaacctagagatatccaggtccacctttgatttgctgagaaat
tcctacggagtgagaaaaggctgcgcactggagcctatccagagtgtgagtttcctgaga
ggcggctatgtggagatgccacccaagtctctctcacctgagtcatccctgctggccaca
ttcgccaccaagaacagcagcggaatcctcctggttgccctgggcaaggatgcggaggag
gctggtggggctcaggcacatgtgcccttcttttccatcatgctgcttgagggacgaatt
gaagtgcatgtcaactctggggacgggaccagtctgaggaaggccctcctgcatgccccc
accggctcctacagtgatggacaggaacactccatctccctggttaggaatcggagagtt
atcaccatacaagtggatgagaacagtcccgtagaaatgaagttgggtccattaacagaa
ggaaagacgatcgacatatccaacctgtacatagggggacttccggaggacaaggcgacc
ccgatgctcaagatgcggacttcgttccatgggtgtattaaaaacgtggtccttgacgct
caacttttggacttcacccatgcgactggctctgagcaagtagagctggacacatgcttg
ctggcagaagagcccatgcagagtctgcacagagaacacggggaactccctccggagccc
ccaactctaccacagcctgaactgtgcgcagtagacacggctccggggtatgtggcaggt
gctcaccagtttggcctctcgcagaacagccacttggtgctccctctgaatcagtctgat
gtccggaagaggctccaggtgcagctgagcattcggacatttgcctccagtggcctcatt
tactatgtggctcatcagaaccaaatggactacgccacgctccagctccaagagggccgc
ctgcacttcatgtttgatctcggcaagggccggaccaaggtctcccaccctgccctgctc
agtgatggcaagtggcacacagtcaagacagaatacattaaaaggaaggcgttcatgact
gttgacggccaagagtcccccagtgtgactgtggtgggcaatgcaaccacgctggatgtg
gaaaggaaactgtacctcggaggccttcccagccactacagggccaggaacatcgggact
atcacccacagcatccctgcctgcattggggaaatcatggttaatggccaacagctggat
aaagacaggcccttgtctgcctctgctgtggacaggtgctatgtcgtggctcaggaagga
actttctttgaaggaagcggatatgcagctcttgtcaaggaaggttacaaagttcgattg
gatttaaatatcacactggagttccgtactacctctaagaatggcgtcctcctgggaatc
agcagtgccaaagtggatgccattggcctagagattgtagatggcaaggtcttatttcac
gtcaacaacggtgccggaaggataacagccacctaccagcccagagccgccagagctctc
tgtgatggcaagtggcacacactccaagcccacaaaagcaagcaccgcatcgtcctgact
gtggacgggaattccgttagggctgaaagcccccacacccattccacctcggcagacacc
aacgatcccatttatgtgggtggctatcctgcccacatcaaacagaactgcctgagcagc
cgggcctcattccggggctgtgtgaggaacctcaggctgagcaggggctcacaagtgcag
tccttggacctgagccgagcctttgacctacaaggagtcttccctcattcctgccccggg
cctgagccctaa

KEGG   Mus musculus (mouse): 16773
Entry
16773             CDS       T01002                                 

Gene name
Lama2, 5830440B04, dy, mKIAA4087, me, mer, merosin
Definition
(RefSeq) laminin, alpha 2
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16773 (Lama2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16773 (Lama2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16773 (Lama2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16773 (Lama2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16773 (Lama2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16773 (Lama2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16773 (Lama2)
   05145 Toxoplasmosis
    16773 (Lama2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16773 (Lama2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16773 (Lama2)
   05414 Dilated cardiomyopathy
    16773 (Lama2)
   05416 Viral myocarditis
    16773 (Lama2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF948 Arfaptin Ribosomal_S15
Other DBs
NCBI-GeneID: 16773
NCBI-ProteinID: NP_032507
MGI: 99912
Ensembl: ENSMUSG00000019899
Vega: OTTMUSG00000045038
UniProt: Q60675 Q5DTP0
Structure
PDB: 

Position
10 A4; 10 14.23 cM
AA seq 3118 aa
MPAATAGILLLLLLGTLEGSQTQRRQSQAHQQRGLFPAVLNLASNALITTNATCGEKGPE
MYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNL
SLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSE
VCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGSTNEDPCVG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWY
LTDLSGRIRMAPQLDNPDSPQQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLSF
TISYDLEEEEDDTEKILQLMIIFEGNDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHG
TNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVC
QCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPY
CNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRC
ERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADG
YFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGC
LPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCD
PKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPK
FSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH
CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQH
TTTKGIAFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE
TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAGSPPAHLIERCDCPP
GYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTA
GDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQ
YCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWH
AREGAECVFCGDECTGLLLGDLARLEQMTMNINLTGPLPAPYKILYGLENTTQELKHLLS
PQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTNSRAESLEEFIKG
LVQDAEAINEKAVQLNETLGNQDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDEL
VAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLS
AANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLP
PMSEELSDKIDDLAQEIKDRRLAEKVFQAESHAAQLNDSSAVLDGILDEAKNISFNATAA
FRAYSNIKDYIDEAEKVAREAKELAQGATKLATSPQGLLKEDAKGSLQKSFRILNEAKKL
ANDVKGNHNDLNDLKTRLETADLRNSGLLGALNDTMDKLSAITNDTAAKLQAVKEKAREA
NDTAKAVLAQVKDLHQNLDGLKQNYNKLADSVAKTNAVVKDPSKNKIIADAGTSVRNLEQ
EADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCVRTYRPEIKK
GSYNNIVVHVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTI
DDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTYHSVSPPGYTILDVDANAMLFVGGL
TGKIKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFD
GEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELSDGHVKVSYDL
GSGMTSVVSNQNHNDGKWKAFTLSRIQKQANISIVDIDSNQEENVATSSSGNNFGLDLKA
DDKIYFGGLPTLRNLSMKARPEVNVKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLE
NVYTVSFPKPGFVELAAVSIDVGTEINLSFSTRNESGIILLGSGGTLTPPRRKRRQTTQA
YYAIFLNKGRLEVHLSSGTRTMRKIVIKPEPNLFHDGREHSVHVERTRGIFTVQIDEDRR
HMQNLTEEQPIEVKKLFVGGAPPEFQPSPLRNIPAFQGCVWNLVINSIPMDFAQPIAFKN
ADIGRCTYQKPREDESEAVPAEVIVQPQPVPTPAFPFPAPTMVHGPCVAESEPALLTGSK
QFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPY
FSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGI
LYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYF
DGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNG
AGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPV
FVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
NT seq 9357 nt   +upstreamnt  +downstreamnt
atgcctgcggccaccgccgggatcctcttgctcctgctcttggggacgctcgaaggctcc
cagactcagcggcgacagtcccaagcgcatcaacagagaggtttatttcctgctgtcctg
aatcttgcttcgaatgcactcatcacaaccaatgctacatgtggggaaaaaggacccgag
atgtactgcaagttggtggaacatgtccccgggcagcctgtgaggaaccctcagtgccga
atctgcaatcagaacagcagcaatccataccagaggcacccgattacgaatgctattgat
ggcaagaacacatggtggcagagtcccagtatcaagaatggagtggaataccattatgtg
acaattactctggatttacagcaggtgttccagattgcctacgtaattgtgaaggcagcc
aattcccctcggcctggaaactggattttggaacgttccctggatgacgtggagtacaaa
ccctggcagtatcatgcggtgacagacacggagtgcctgaccctctacaatatctatccc
cgcactggaccaccatcctacgccaaagatgatgaggtcatctgcacttcattttattcg
aagatccaccctttagaaaatggagagattcacatttctttgatcaatgggagaccaagt
gctgatgacccctcccctgaactcctggaattcacctctgctcgctacattcgcctgaga
tttcagaggatccgcaccttgaatgcagacttgatgatgtttgctcacaaagaccccaga
gaaatcgatcccattgtcacacgaagatattactattctgtcaaggatatttcagttggc
gggatgtgcatctgttatggtcatgcccgggcttgtccacttgaccctgcaacaaataaa
tcacgctgtgagtgtgaacataacacctgtggggaaagctgtgacaggtgctgtccagga
ttccatcagaagccttggagagctggaaccttcctcaccaagtctgagtgtgaagcatgc
aattgtcacggaaaagctgaggaatgctattatgatgaaactgttgctagcagaaatcta
agtttaaatatacatgggaagtacatcggagggggtgtgtgcatcaactgcacacataac
acggctgggataaattgtgagacatgtgttgatggattcttcagaccaaaaggggtatca
ccaaattatccaagaccatgccagccatgtcactgtgatccaactggctcccttagtgaa
gtctgtgtcaaagatgagaaatatgcccagcgagggttgaaacctggatcctgtcactgc
aaaactggctttggaggcgtgaactgtgatcgctgtgtcaggggttaccatggttaccca
gactgccaaccctgtaactgtagtggcttggggagcacaaacgaggacccttgcgttggg
ccctgtagctgtaaggagaatgttgaaggtgaagactgtagtcgttgcaaatctggtttc
ttcaacttgcaagaagataatcagaaaggctgtgaggagtgtttctgttcaggagtatca
aacagatgtcagagttcctactggacctatgggaatattcaagacatgcgtggttggtat
ctcacagacctctctggccgcattcggatggctccccagcttgataaccctgactcacct
cagcagatcagcatcagtaactctgaggcccggaaatccctgcttgatggttactactgg
agtgcaccgcctccatatctgggaaacagacttccagctgttggaggacagttgtcattt
accatctcatatgacctcgaagaagaggaagacgatacagaaaaaatccttcagctgatg
attatctttgagggaaatgacttaagaatcagcacagcgtataaggaggtgtacttagag
ccatctgaagaacacattgaggaggtgtcactcaaagaagaggcctttactatacatgga
acaaatttgccagtcactagaaaagatttcatgattgttctcacaaatttggagagagtc
cttatgcaaatcacatacaacttagggatggacgccatcttcaggctgagttctgtcaat
cttgaatctgctgtcccttatcctactgatagacgtattgcaactgatgtggaagtttgc
cagtgtccacctgggtacagtggcagctcttgtgaaacatgttggcctaggcaccgaaga
gttaacggcaccatttttggtggcatttgtgaaccatgtcagtgctttgctcatgcagaa
gcctgtgatgacatcacaggagaatgtctgaactgtaaggatcacacaggtgggccgtac
tgcaatgaatgtctccctggtttctatggtgatcctactcgaggaagccctgaagactgt
cagccctgtgcctgtccactcaatatcccatcaaataactttagtccaacatgccattta
gaccggagtctgggattgatctgtgacgagtgtcctattgggtacacaggaccgcgctgt
gagaggtgtgcagaaggctattttggacaaccttccatacctggaggatcatgtcagcca
tgccaatgcaatgacaaccttgactactccatccctggcagctgtgacagcctgtctggc
tcctgtctgatttgtaagccaggtacaacaggccggtactgtgagctctgtgctgatggg
tattttggagacgcggttaatgcaaagaactgtcaaccatgccgttgtaatatcaatggc
tccttctcagagatttgtcacactagaactgggcaatgtgagtgcagacccaatgtgcag
gggcggcactgtgacgagtgtaagcctgaaacctttggcctgcaactgggaaggggttgt
ctgccctgcaactgcaattcttttgggtctaagtcctttgactgtgaagcaagtgggcag
tgctggtgccagcctggagtagcagggaagaaatgtgaccgttgtgcccatggctacttc
aacttccaagaaggaggctgcatagcttgtgactgttctcatctgggcaacaactgtgac
ccaaaaactggccaatgcatttgcccacccaataccactggagaaaagtgttctgagtgt
cttcccaacacctggggtcacagcattgtcaccggctgtaaggtttgtaactgcagcact
gtggggtccttggcttctcagtgcaatgtaaacacgggccagtgcagctgtcatccaaaa
ttctctggtatgaaatgctcagagtgcagccgaggtcactggaactatcctctctgcact
ctatgtgactgcttccttccagggacagatgccacgacttgtgatctggagactaggaaa
tgctcctgtagtgatcaaactggacagtgcagctgtaaggtgaatgtggaaggcgtccac
tgtgacaggtgccggcctggcaaatttggactagatgccaagaacccacttggctgcagc
agctgctactgctttggagttactagtcaatgctctgaagcaaaggggctgatccgtacg
tgggtgactttgagtgatgaacagaccattctacctctggtggatgaggccctgcagcac
acgactaccaaaggcattgctttccagaaaccagagattgttgcaaagatggatgaagtc
aggcaagagctccatttggaacctttttactggaaactcccacaacaatttgaagggaaa
aagttgatggcttatggtggcaaactcaagtatgccatctattttgaggctcgggatgag
acaggctttgccacatataaacctcaagttatcattcgaggtggaactcctactcatgct
agaattattaccagacacatggctgcccctctcattggccagttgacacggcatgaaata
gaaatgacagagaaagaatggaaatattatggtgatgatcctcgaatcagtagaactgtg
acccgtgaagacttcttggatatactatatgatattcactatatccttatcaaggctact
tatggaaacgttgtgagacaaagccgcatttctgaaatctccatggaagtagccgaacca
ggacatgtattagcagggagcccaccagcacacttgatagaaagatgcgattgccctcct
ggctattctggcttgtcttgtgagacgtgtgcaccaggattttatcgacttcgttctgaa
ccaggtggccgcactcctggaccaaccttaggaacctgtgttccctgccaatgtaatgga
cacagcagtcagtgtgatcctgagacctcagtatgccagaattgtcagcatcacactgct
ggtgacttctgtgagcgctgtgcccttggctactatggaatcgtcaggggattgccaaat
gactgtcaaccatgtgcttgtcctctgatttcgcccagcaacaatttcagcccctcttgt
gtattggaaggtctggaagattaccgttgcaccgcctgcccaaggggctatgaaggacag
tactgtgaaaggtgtgccccaggctatactggcagcccaagcagccccggaggctcctgc
caagaatgtgagtgtgacccttatggctccctaccggttccctgtgaccgggtcacggga
ctctgcacgtgccgccctggagccacaggaaggaagtgtgatggctgcgagcactggcat
gcacgcgagggtgcagagtgtgtcttttgtggagacgagtgtacaggccttcttcttggt
gacctggctcgtctagagcagatgaccatgaacatcaacctcacgggcccactgcctgct
ccatataaaattctgtatggtcttgaaaatacaactcaggaactcaagcacctgctatca
ccgcaacgggcaccagagaggctcattcagttggcagagggcaacgtgaacacacttgtg
atggaaacaaatgagctgctaaccagagcaaccaaagtgacagcagatggtgagcaaaca
ggacaagatgctgagaggaccaactccagagcagaatccttggaagaattcattaaaggg
cttgtccaggatgctgaagccataaatgaaaaagctgtacaactaaatgaaaccttagga
aatcaagataagacagcagagagaaacttggaggagcttcaaaaggaaatcgaccggatg
ctgaaggaactgagaagtaaagatcttcaaacacagaaggaagttgctgaggatgagctc
gtggcagcagaaggccttctgaagagagtaaacaagctgtttggagagcccagagcccag
aatgaagatatggaaaaggatctccagcagaaactggcagagtacaagaacaaacttgat
gatgcttgggatctattgagagaagccactgataaaactcgagatgctaatcgtttgtct
gctgccaatcaaaaaaacatgaccatactggagacaaagaaggaggctattgaaggtagc
aaacgacaaatagagaacactttaaaggaaggcaatgacatccttgatgaagccaatcga
ctcttaggtgaaatcaactcagtcatagattatgtcgacgacattaaaactaagttgcca
ccaatgtccgaggagctgagtgacaaaatagatgacctcgcccaggaaataaaggacaga
aggcttgctgagaaggtgttccaggctgagagccatgctgctcagctgaacgactcgtct
gctgtacttgatggaatcctggatgaggctaagaacatctctttcaatgccacggcagcc
ttcagagcttacagtaatattaaagactacattgatgaagctgagaaagtggccagagaa
gccaaagagcttgcccaaggggctacaaaactggcaacaagtcctcagggcttattaaaa
gaagatgccaaaggctcccttcagaaaagcttcaggatcctcaatgaagccaagaagcta
gcaaacgatgtgaaaggaaatcacaatgatctaaatgacctgaaaaccaggttagaaact
gctgaccttagaaacagtggacttctaggagctctaaatgacaccatggacaagttatca
gccattacaaatgacacggctgctaaactgcaggctgtcaaagagaaagccagagaagcc
aatgacacagcaaaagctgtcctggcccaggttaaggacctgcatcagaacctagatggc
ctgaagcaaaactacaataaactggcagacagcgtggccaaaacgaacgctgtggtgaaa
gatccttccaaaaacaaaatcattgcagatgcaggcacttccgtgagaaatctagaacag
gaagctgaccggctaatcgacaaactcaagcccatcaaggagcttgaggacaacctaaag
aaaaacatttctgaaataaaggaactgatcaaccaagctcggaaacaagctaactctatc
aaagtatctgtttcttcgggaggtgactgtgttcgaacatacaggccagaaatcaagaaa
ggaagctacaataacatcgttgtccatgtcaagaccgctgttgccgacaacctccttttt
tatcttggaagtgccaaatttattgactttcttgctatagaaatgcgcaaaggcaaagtc
agcttcctctgggatgttggctctggagttggccgagtagagtatccagacttgaccatc
gacgactcctattggtaccgtattgaagcatcaagaacgggaagaaatggatctatttct
gtgagagctttagatggacccaaagccagtatggtacccagcacctaccattcagtgtct
cctcccgggtacactatcctagatgtggatgcaaatgcaatgctgtttgttggtggcctg
accggaaaaataaagaaggccgatgctgtacgtgtgatcaccttcaccggctgtatggga
gaaacatactttgacaacaaacctataggtttatggaacttccgggagaaagaaggcgac
tgtaagggatgtactgtcagcccacaagtggaagatagtgaggggactattcagtttgat
ggtgaaggctatgcattagtgagccgccctatccgctggtaccccaacatctccacagtc
atgttcaagttccggacattttcatcaagtgctctcctgatgtatcttgccacacgagac
ctgaaagatttcatgagtgtagagctcagtgatggacatgtgaaagtcagctatgacctg
ggctcaggaatgacttccgttgtcagcaatcaaaaccataatgatgggaaatggaaagca
ttcacgctgtcgcggattcagaaacaagccaacatatcgattgtcgacatcgattctaac
caggaggagaatgtagctacttcatcttctggaaacaactttggtcttgacttgaaagca
gatgacaaaatatattttggtggcctgccaactctgagaaacttgagtatgaaagcaagg
ccagaagtcaatgtgaagaaatactccggctgcctcaaagatattgaaatttcaagaaca
ccttacaatatactcagcagccctgattatgttggtgtgaccaaaggctgttcactggag
aatgtttatacagttagtttccccaagcctggttttgtggagcttgccgctgtgtctatt
gatgttggaacagaaatcaatctgtcctttagtaccaggaacgagtctgggatcattctc
ttgggaagtggagggacactcacaccacccaggagaaaacggagacaaaccacacaggct
tattatgccatattcctcaacaagggccgcttggaagtgcatctctcctcggggacacgg
acaatgaggaaaattgtcatcaaaccggagccaaatttgtttcatgatgggagagaacat
tctgtccacgtagaaagaaccagaggcatcttcactgttcaaattgatgaagacagaaga
catatgcaaaacctgacagaggaacagcccatcgaagtgaaaaagctctttgtcgggggt
gctcctcctgaatttcagccctccccactcaggaatattccggcctttcaaggctgtgtg
tggaaccttgttattaactccatccccatggactttgcgcagcctatagccttcaaaaat
gccgacattggccgctgtacctatcaaaagccccgggaagatgagagtgaagcagttcca
gctgaagttattgtccagcctcagccggtgcccacccctgccttccctttcccggccccc
accatggtgcatggcccttgtgttgcagaatcagaaccagctcttctgacagggagcaag
cagtttgggctttccagaaacagccacattgcaattgcttttgatgacaccaaagttaaa
aatcgcctcaccattgagctggaggtacgaactgaagctgaatcaggcttgctcttctac
atggctcggatcaatcatgctgattttgctactgttcagctgaggaatggcttcccgtac
ttcagttatgatttggggagtggggacacaagcaccatgatccccacaaaaatcaacgat
ggccagtggcacaagattaagattgtgagagtgaagcaggagggaattctttatgtggat
gatgcctccagccaaaccatcagtcccaagaaagctgacatcctggatgtcgtggggatt
ctgtatgtcggtggattgccgatcaactataccacacgcagaattggtccagtgacttac
agcctggatggctgtgttaggaatcttcacatggaacaagcccctgttgatctggaccag
cctacctccagctttcacgttgggacatgctttgcgaatgcagagagtgggacttacttt
gatggaaccggttttgctaaagcagttggtgggttcaaagttggattggaccttcttgtg
gaatttgaattccgtaccacaagacccactggggtcctcctgggagtcagcagtcagaag
atggatggaatgggtattgaaatgatcgacgagaagcttatgttccacgtggataatggc
gctggccgattcactgcaatctatgatgctgggatcccaggccacatgtgcaatggacag
tggcataaagtcactgccaagaagatcaaaaaccgtcttgagctggtggtagatgggaac
caggtggatgcccagagcccaaactcagcatcgacatcagctgatacaaacgaccctgtt
tttgttggcggtttcccaggtggcctcaatcagtttggcctgaccaccaacattaggttc
cgaggctgcatccgatctctgaagctcaccaaaggcactggcaaaccgctggaggttaat
tttgccaaggccctggaactgaggggtgttcaacctgtatcatgcccgactacctaa

KEGG   Mus musculus (mouse): 16774
Entry
16774             CDS       T01002                                 

Gene name
Lama3, Lama3B, [a]3, [a]3B
Definition
(RefSeq) laminin, alpha 3
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16774 (Lama3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16774 (Lama3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16774 (Lama3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16774 (Lama3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16774 (Lama3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16774 (Lama3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16774 (Lama3)
   05145 Toxoplasmosis
    16774 (Lama3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_G_2 Laminin_N Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 16774
NCBI-ProteinID: NP_034810
MGI: 99909
Ensembl: ENSMUSG00000024421
Vega: OTTMUSG00000045059
UniProt: Q61789
Position
18 A1; 18 6.2 cM
AA seq 3330 aa
MAVALGRAPRSLPLLLTLLLLLLLRMSPSWSVVGQDHPMSSRSLHPPYFNLAQAARIWAT
ATCGERDPEVSRPRPELFCKLVGGPAAQGSGHTIQGQFCDYCNSEDSRKAHPASHAIDGS
ERWWQSPPLSSGTQYNQVNLTLDLGQLFHVAYILIKFANSPRPDLWILERSVDFGSTYSP
WQYFAHSRRDCVEQFGQEANMAITQDDQMLCVTEYSRIVPLENGEIVVSLINGRPGAKKF
AFSDTLREFTKATNIRLRFLRTNTLLGHLISKAERDPTVTRRYYYSIKDISVGGRCVCNG
HAEACSADNPEKQFRCECQHHTCGDTCNRCCAGYNQRRWQPAGQEQHNECEACNCHGHAV
DCYYDPDVEHQQASLNSKGVYAGGGVCINCQHNTAGVNCEKCAKGYFRPHGVPVDALHGC
IPCSCDPERADDCDQGSGHCHCKPNFSGDYCETCADGYYNFPFCLRIPVFPNYTPSPEDP
VAGNIKGCDCNLEGVLPEICDDRGRCLCRPGVEGPQCDSCRSGSYSFPICQACQCSTIGS
YPVPCDPGNGQCDCLPGITGRQCDRCLSGAYDFPYCQGSGSVCHPAGTLDSSLGYCQCKQ
HVASPTCSVCKPLYWNLAKENPRGCSECQCHEAGTLSGIGECGQEDGDCSCKAHVTGDAC
DTCEDGFFSLEKSNYFGCQGCQCDIGGALTTMCSGPSGVCQCREHVEGKQCQRPENNYYF
PDLHHMKYEVEDGTGPNGRNLRFGFDPLVFPEFSWRGYAPMTSVQNEVRVRLSVRQSSLS
LFRIVLRYISPGTEAISGRITLYSSQGDSDALQSRKITFPPSKEPAFVTVPGNGFAGPFS
ITPGTWIACIQVEGVLLDYLVLLPRDYYEAFTLQVPVTEPCAHTGSPQDNCLLYQHLPLT
AFSCTLACEARHFLLDGELRPLAMRQPTPTHPAMVDLSGREVELQLRLRVPQVGHYVVLL
EYATEVEQLFVVDVNLKSSGSALAGQVNIYSCKYSIPCRSVVIDSLSRTAVHELLADADI
QLKAHMAHFLLYHICIIPAEEFSTEYLRPQVHCIASYRQHANPSASCVSLAHETPPTASI
LDATSRGLFSALPHEPSSPADGVTLKAPQSQVTLKGLIPHLGRHVFVIHFYQAEHPGFPT
EVIVNGGRQWSGSFLASFCPHLLGCRDQVISDGQVEFDISEAEVAVTVKIPDGKSLTLVR
VLVVPAENYDYQILHKTTVDKSSEFISSCGGDSFYIDPQAASGFCKNSARSLVAFYHNGA
IPCECDPAGTAGHHCSPEGGQCPCRPNVIGRQCSRCATGYYGFPYCKPCNCGRRLCEEVT
GKCLCPPHTVRPQCEVCEMNSFNFHPVAGCDVCNCSRKGTIEAAVSECDRDSGQCRCKPR
VTGQQCDKCAPGFYQFPECVPCSCNRDGTEPSVCDPETGACMCKENVEGPQCQLCREGSF
YLDPTNPKGCTKCFCFGVNTDCQSSHKQRAKFVDMMGWRLETADGVDVPVSFNPGSNSMV
ADLQELPPSVHSASWVAPPSYLGDKVSSYGGYLTYHAKSFGLPGDMVLLGKQPDVQLTGQ
HMSLIHKEPSDPRPDRLHHGRVQVIEGNFRHEGSSAPVSREELMTVLSRLERLHIRGLHF
TETQRLTLGEVGLEEASDTGSGPRAHLVEMCACPPDYTGDSCQGCRPGYYWDNKSLPVGR
CVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCQAGHYGNAIHGSCRVCPCPHTNSFA
TGCAVDGGAVRCACKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNCNSNGQLGPCDPLTG
DCVNQEPKDGSPAEECDDCDSCVMTLLNDLASMGEELRLVKSKLQGLSVSTGALEQIRHM
ETQAKDLRNQLLGFRSATSSHGSKMDDLEKELSHLNREFETLQEKAQVNSRKAQTLYNNI
DQTIQSAKELDMKIKNIVQNVHILLKQMARPGGEGTDLPVGDWSRELAEAQRMMRDLRSR
DFKKHLQEAEAEKMEAQLLLHRIRTWLESHQVENNGLLKNIRDSLNDYEDKLQDLRSILQ
EAAAQAKQATGINHENEGVLGAIQRQMKEMDSLKNDFTKYLATADSSLLQTNNLLQQMDK
SQKEYESLAAALNGARQELSDRVRELSRSGGKAPLVVEAEKHAQSLQELAKQLEEIKRNT
SGDELVRCAVDAATAYENILNAIRAAEDAASKATSASKSAFQTVIKEDLPKRAKTLSSDS
EELLNEAKMTQKRLQQVSPALNSLQQTLKTVSVQKDLLDANLTVARDDLHGIQRGDIDSV
VIGAKSMVREANGITSEVLDGLNPIQTDLGRIKDSYESARREDFSKALVDANNSVKKLTR
KLPDLFIKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVRLP
NDLEDLKGYTSLSLFLQRPDLRENGGTEDMFVMYLGNKDASKDYIGMAVVDGQLTCVYNL
GDREAEVQIDQVLTESESQEAVMDRVKFQRIYQFAKLNYTKEATSTKPKAPGVYDMESAS
SNTLLNLDPENAVFYVGGYPPGFELPRRLRFPPYKGCIELDDLNENVLSLYNFKTTFNLN
TTEVEPCRRRKEESDKNYFEGTGYARIPTQPNAPFPNFMQTIQTTVDRGLLFFAENQDNF
ISLNIEDGNLMVKYKLNSEPPKEKGIRDTINNGRDHMILISIGKSQKRMLINMNKHSIII
EGEIFDFSTYYLGGIPIAIRERFNISTPAFQGCMKNLKKTSGVVRLNDTVGVTKKCSEDW
KLVRTASFSRGGQMSFTNLDVPSLDRFQLSFGFQTFQPSGTLLNHQTRTSSLLVTLEDGH
IALSTRDSSSPIFKSPGTYMDGLLHHVSVISDTSGLRLLIDDQVLRRNQRLASFSNAQQS
LSMGGGYFEGCISNVFVQRMSQSPEVLDMASKSTKRDAFLGGCSLNKPPFLMLFKSPKGF
NKARSFNVNQLLQDAPQAARSIEAWQDGKSCLPPLNTKATHRALQFGDSPTSHLLFKLPQ
ELLKPRLQFSLDIQTTSSRGLVFHTGTRDSFVALYLSEGHVIFALGAGGKKLRLRSKERY
HDGKWHSVVFGLSGRKVHLVVDGLRAQEGSLPGNSTISPREQVYLGLSPSRKSKSLPQHS
FVGCLRNFQLDSKPLDSPSARSGVSPCLGGSLEKGIYFSQGGGHVVLANSVSLEPALTLT
LSIRPRSLTGVLIHIASQSGEHLSVYMEAGKVTTSMNSEAGGTVTSITPKRSLCDGQWHS
VTVSIKQHTLHLELDTDNSYTAGQLSFPPNSTRGSLHIGGVPDKLKMLTLPVWNSFFGCL
KNIQVNHIPVPITEATDVQGSVSLNGCPDH
NT seq 9993 nt   +upstreamnt  +downstreamnt
atggcggtggctctgggcagggcaccgcgatccttaccgctgctgctcactctattgctg
ctgctgttgctgaggatgtcgcccagctggagcgtggtgggtcaggaccatcccatgtcc
tcgcgcagcctgcacccgccctacttcaacctggcccaggcggcgagaatctgggccacc
gccacctgcggggagcgggacccagaggtctcaaggccccggcctgagcttttctgcaaa
ttggtgggcggccccgctgcacagggcagcggccacaccatccagggccagttctgtgac
tactgcaattctgaggattccaggaaggcacatccagccagccatgcaattgatggatcg
gaacggtggtggcaaagcccacctctctcctccggcacacagtacaatcaagtcaacctc
accttggatctgggtcagctcttccatgtggcttatatcttaatcaaatttgcaaactct
ccccgccctgatctttggatcctggaaagatctgtagactttggaagcacctactcacca
tggcagtattttgctcattctagaagagattgtgtagaacagtttgggcaagaagcaaac
atggcaattacccaggacgaccagatgctctgtgtcacggagtattcccgtatcgtgcct
ctggaaaatggcgagattgttgtatccttgataaatggtcgtccaggtgcaaaaaagttt
gctttctctgacactctgagggagtttactaaggcaacaaacatccgcttgcggtttctg
cgaaccaacaccctcctcgggcatcttatttccaaggcagagcgagaccccactgtcacg
cgccggtattattacagcataaaggatatcagtgttggtgggcggtgtgtttgcaacggc
catgcggaggcgtgcagtgctgacaaccctgaaaagcagttccgatgcgaatgccagcac
catacctgtggagacacgtgtaaccgctgctgtgcaggttacaatcagaggcgctggcag
cctgctggtcaggagcagcacaatgagtgtgaagcctgcaactgccatgggcatgctgtg
gactgctactatgacccagacgtggagcaccagcaggcgagcttgaacagcaaaggcgtc
tacgcaggtggaggggtctgcatcaactgtcagcacaacactgcaggcgtgaactgtgaa
aagtgtgcgaagggttacttccggccccatggagttccggtggatgcactgcatggatgc
atcccttgcagctgtgacccagaacgcgcagatgactgtgaccagggctcaggccactgc
cattgtaagccaaatttctccggagactactgtgagacgtgtgcagatgggtactataat
tttccattttgcttgagaattccagtctttcccaactacactccaagtccagaagatcca
gtggctggcaatataaaagggtgtgactgtaacttggaaggtgttctcccagagatatgt
gacgatcgtggcaggtgcctgtgccgccctggggttgagggtccccagtgtgactcctgc
cgctcgggctcctattcatttcccatatgccaagcttgccagtgttcgacgattggatcc
tatccagtgccctgtgacccggggaatggccagtgtgactgcctgcctggaattaccggg
aggcagtgtgacaggtgtctctcgggagcctatgactttccatactgccaagggtccggc
agtgtttgccatccagctgggacccttgactccagcctgggttattgtcagtgcaagcag
catgttgcaagtcctacatgtagtgtctgcaaaccattatattggaatctggccaaagaa
aacccccgtggatgctcagagtgccagtgccatgaagcagggacattgagtggaattgga
gagtgtgggcaggaggacggtgactgtagctgcaaagcccatgtaactggtgatgcctgc
gacacctgtgaagatgggtttttctctttggagaagagcaattactttggctgtcaaggg
tgtcagtgtgacattggtggagcactcaccaccatgtgtagtgggccctcgggagtatgc
cagtgcagagagcacgtggaggggaaacagtgccagaggcctgaaaataactactacttc
ccggatttgcaccacatgaagtatgaggtcgaagatggcactggacctaatggaagaaac
ctgcggtttggatttgatcccctggtattccctgagtttagctggagaggatatgctcca
atgacctcagtccagaatgaagtaagggtgagattgtctgtgaggcagtccagcctctcc
ttgttccgcatcgttctgagatacatcagtcctggaacggaagccatatccggccgaatc
actctttactcatcgcagggagattcggatgctttgcaaagcagaaaaatcacctttccc
ccgagtaaagagccagcctttgtcacagtccctgggaatggctttgcaggcccattctcc
atcacacctgggacgtggattgcttgcatccaggtggaaggagtccttctggactacctg
gtgctgcttcccagggactactatgaagcattcaccctgcaagtgccagtcacagagcca
tgtgcccacacaggatctccccaggacaactgtttgctttaccagcatttaccactgact
gcattctcctgtaccctggcttgtgaggccagacacttcctgctggatggagagctgaga
cccttggcaatgaggcagcccacacccacacacccagccatggtggacctcagcgggaga
gaggtagaactgcagcttcgtctgcgggtcccacaggttggccactacgtggtcctgctg
gagtatgccacggaggtggagcagctttttgtggtggacgtgaatctgaagagctcaggg
tctgccttggcaggccaggtgaacatatacagctgcaagtacagcatcccgtgcaggagt
gtggtgattgacagcctgagtcgcacggctgtacatgagctgttggcagatgcagacatt
cagctcaaggcgcacatggcccatttccttttgtatcacatttgtattataccagctgaa
gaattctcaactgaatatttgagacctcaagtccactgcattgccagctacaggcagcat
gctaatccaagtgcttcctgtgtctccctggcccatgaaactcctccaacagcctcaatt
ttggatgctacaagtaggggccttttctctgccctacctcatgagccttcctctcctgca
gatggagttactctgaaggcaccacagagtcaagtgaccctgaaaggactcataccacac
ctgggccgacacgtctttgtcatccatttttatcaagcagagcacccagggtttcccact
gaggtgattgtgaatggaggaagacagtggtcaggttccttccttgcctccttctgtccc
cacttacttggctgccgggaccaggtgatctctgatggccaagtggagtttgacatctct
gaagcagaggtagctgtgacagtgaagattccagatggaaagtccttaacattggtccgg
gttctagtggtacctgcagagaattacgactaccaaattcttcacaaaacaacagtggac
aagtcctccgagttcatcagcagttgtggaggagacagcttttatattgatccccaggca
gcctctggattctgtaagaattctgcaaggtccctggtagccttttaccataacggtgcc
ataccctgtgagtgcgaccctgctgggactgccggccaccactgtagtcctgagggtggg
cagtgcccttgccggcccaatgtcatcgggaggcagtgcagccgctgtgcgacaggctac
tatggattcccatactgcaagccttgtaattgtggcagacgcctttgtgaagaggtgaca
gggaagtgtctctgcccaccccacacagtcaggcctcagtgtgaggtctgtgagatgaat
tccttcaactttcaccctgtggctggctgtgacgtctgcaactgctccaggaagggcacc
attgaggcggccgtctctgagtgtgacagggacagcgggcagtgcaggtgcaagcctaga
gtcacagggcagcagtgtgacaagtgtgctcctggcttctaccagttccctgagtgtgtc
ccctgcagctgtaacagagatgggactgagcccagcgtatgtgacccagagactggggct
tgcatgtgcaaggaaaatgtagagggcccccaatgtcaactgtgtcgagaaggatcattc
tacctggacccaacaaacccaaagggttgtaccaagtgcttctgttttggagtgaatact
gactgtcagagttcgcataagcaacgagctaagtttgtagacatgatgggctggcgtctg
gagacagcagatggagttgatgtccctgtgtccttcaaccctggcagcaacagcatggtg
gcagatctgcaggagctgccaccctcagttcacagtgcatcctgggtggcacctccatcc
tacctaggtgataaggtatcatcgtacggcggctacctcacctaccacgccaagtccttt
ggcttacctggagatatggttcttctgggaaagcagccagatgtgcagctcactggtcaa
cacatgtccctcatccataaggaacccagcgacccacggccagacaggctgcatcacgga
agagtgcaagtgattgagggaaacttcagacacgaaggcagcagtgccccagtgtcccgg
gaggagctgatgactgtgctgtccagactggaaagactccacatccggggcctccatttc
accgagacacagcggctcaccttgggtgaggtagggctggaggaggcctctgacacggga
agcggacccagggctcatcttgtggagatgtgtgcctgcccccctgactacacaggtgac
tcatgccagggttgtcgccctggatactattgggacaacaaaagcttacctgtaggaagg
tgtgttccctgcaattgcaacggacattcaaatagatgccaggatggctccgggatatgc
attaactgtcagcacaacacagctggggagcactgtgagcgttgccaagcaggtcactat
ggaaatgccatccacggatcttgtagggtctgcccctgccctcataccaacagttttgcc
accggctgtgctgtggatggtggagctgtgaggtgtgcctgcaaacccggatacacagga
acacagtgtgagaggtgtgcaccaggatattttgggaacccccagaaatttggaggtagc
tgccagccatgcaattgtaacagcaatggccagttaggtccttgcgaccccctaactgga
gactgtgtaaaccaagaacccaaagatggcagccctgcagaagaatgtgatgactgcgac
agctgtgtgatgacgctcttaaatgacttggcctccatgggtgaggaactccgcctggtg
aagtcaaagctgcaggggctgagtgtgagcacgggtgctctggaacagatccggcacatg
gagacgcaggccaaggacctgaggaaccagctgcttggcttccgttctgccacctcaagt
catgggtccaaaatggatgacctggaaaaagagctgagtcatttgaaccgggaatttgaa
actctgcaagaaaaggcacaggtcaattccagaaaagcacaaacattatataacaacatt
gatcagacaatccaaagtgccaaagaactggacatgaagattaaaaacatcgttcagaat
gtgcacattctcctgaagcagatggcgaggccaggtggagaaggcacggacttgccagtg
ggtgactggtccagggagctggccgaagctcaacgcatgatgcgagacctgcgaagccga
gactttaaaaagcacctccaagaagcagaggccgagaaaatggaagcccagctcttactg
caccggatcaggacctggctggaatcccaccaggtggagaacaacggactgctaaagaat
attcgggactccttaaatgattatgaagacaaacttcaggacctacgttccatcctccag
gaggcagctgcccaggcaaagcaggccactggcatcaaccatgaaaatgagggggttctc
ggagccatccagagacaaatgaaagaaatggattccctgaagaatgacttcaccaagtac
ctggccacagccgactcttccctgctgcagaccaacaatctactgcagcagatggacaaa
agccagaaggaatatgaaagcttagctgctgctttaaatggagcaagacaggaactgagt
gacagagtgcgagaactgtccagatcgggtggcaaagcaccgctggtggtggaggcagag
aagcatgcacagtctttacaggagctggcaaagcagctggaagagataaagagaaacacc
agcggggatgagctggtgcgttgtgctgtggatgctgccacggcctatgagaacatcctc
aatgccatcagagcagcagaggatgcagccagcaaggccaccagtgcctccaagtctgcc
ttccaaacagtgataaaggaagaccttccaaaaagagctaagaccctgagttctgacagc
gaggaactgttaaatgaagccaagatgacacagaaaaggctacagcaagtcagtccagct
ctcaacagcctacaacaaaccctgaagactgtatcagttcagaaggacctgctagatgcc
aacctcactgttgcccgtgatgatcttcatgggatacagagaggtgatatcgacagtgtg
gtgatcggtgcaaagagcatggtcagggaagccaacggaataacaagcgaggtcctggac
gggctcaaccccatccagacagatttgggaaggattaaggacagctatgagagcgcacgg
cgtgaagacttcagcaaggctctggtcgatgccaataactcagtaaagaaattaaccagg
aagttgcctgatctttttatcaagattgaaagtatcaaccaacagttgctgcccctgggg
aacatctctgacaatgtggaccgaatccgagaactcattcagcaggccagagatgctgca
aacaaggttgcaattcccatgaggttcaatggtaaatctggtgtcgaagtccgactgccg
aatgacctagaagatttaaaaggatacacatctctgtctttgtttctccaaagacctgac
ttgcgagagaacggaggcactgaggatatgtttgtaatgtaccttgggaataaggatgcc
tccaaggactacattggcatggcggttgtagatggccagctgacatgtgtgtacaacctg
ggggaccgagaggctgaagttcagatagaccaggtcctgacggagagtgagtctcaggag
gcagttatggaccgggtgaagttccagaggatatatcaatttgccaagcttaattacacc
aaagaagccacatctactaaacccaaagcccctggggtctatgacatggagagcgccagt
agcaacacactccttaatttggatcctgagaatgcagtattttacgtcggcggttatcca
cctggttttgagcttccacgcagactgcggttccctccatacaaaggctgtatcgaacta
gatgacctcaacgaaaacgttctaagcttgtacaatttcaagacaactttcaatctcaat
accactgaagtagagccttgtaggaggagaaaggaagagtcggacaaaaattactttgaa
ggcacaggctatgctcgaattcctacccagccaaatgctcccttcccaaacttcatgcag
accatccaaactactgtggacagaggtctactgttcttcgcagaaaaccaggataacttc
atatctctgaatatagaagacggcaatctcatggtaaaatacaaactaaattcagagcca
cccaaagagaaaggaattcgagacaccatcaacaacgggagagatcacatgattttaatc
tcaattggaaaatcacaaaagcggatgttgataaatatgaataaacatagtataataatt
gaaggggaaatatttgatttcagcacatattacttgggaggaattccaattgcaatcaga
gaaaggtttaacatctcaacgcctgctttccaaggctgcatgaagaatctgaagaaaacc
agtggggttgtcaggttgaacgatacagtgggtgtgaccaaaaagtgctcagaagactgg
aagcttgtgcgaaccgcctcgttctccagaggaggacagatgagtttcacaaacttggat
gtgccctcacttgaccgcttccagctctcctttgggttccagacctttcaacccagcggt
acactactaaaccatcagacacggacaagtagcctactggtcaccctggaagatggtcat
attgcgttgagcaccagggacagcagcagcccgattttcaagtctccagggacctacatg
gatggtttactgcatcatgtatctgtaataagcgacacctcaggcctgcgccttctcatc
gatgaccaggttctgagaagaaaccaaaggctcgctagcttctctaatgcccagcagtcg
ctcagcatgggaggcggttatttcgagggttgtatcagcaacgtttttgtccaaaggatg
tcacagagtccagaagtcctggatatggccagcaagtctactaagagggatgcattccta
ggaggctgcagtttaaacaagccaccttttcttatgttgtttaagagtcccaagggattt
aacaaggcccggagtttcaatgtcaatcagctgttgcaagatgcacctcaggctgcaagg
agcatagaggcttggcaagatgggaagtcctgcctaccacctctgaacaccaaggccact
cacagagccctgcagtttggggacagtcctaccagccacttgctattcaagcttccccag
gagctgctgaaacccaggttacagttttctttggacatacagacaacttcctccagaggg
ctagtgtttcacacaggcaccagggactcctttgtggctctctatctctcagaaggccat
gtcatctttgccttgggggcaggagggaagaaactgagactcagaagcaaagagagatac
cacgatgggaagtggcactcggtggtgtttggactgagtggaagaaaggtgcacctggtg
gtggatgggctgagggcccaggaaggcagtttgcctggaaactctaccatcagccccaga
gaacaggtttacctggggttgtcaccatcaagaaagtcaaagagcctcccccagcacagt
tttgtggggtgtctgaggaacttccagttggactcaaaacccctggattccccctctgcg
aggtctggggtatctccctgcttaggtggctctttggagaaaggcatttatttctcccaa
ggaggaggtcacgtggtcctagccaattccgtgtccttggagccagcacttacgctcact
ctcagcattcgcccacgaagtctcaccggggtcttgatccacatcgcaagtcaatctgga
gagcacttaagtgtctacatggaggcagggaaggtcacgacctctatgaacagtgaggca
ggtgggaccgtgacatcaattacaccgaagagatctctgtgtgatggacaatggcactcg
gtgacagtctccattaaacagcacactctgcatctggaactggatacagacaatagctac
acagctgggcagctttccttcccaccgaacagcacccgagggtcactacacattggaggc
gtcccagacaaattgaaaatgcttacactccctgtgtggaactcattttttggctgtctg
aagaatattcaagtaaaccacatccctgtccccatcacagaagccaccgatgtccaaggt
tctgtcagcctgaatggctgccctgaccactaa

KEGG   Mus musculus (mouse): 16775
Entry
16775             CDS       T01002                                 

Gene name
Lama4
Definition
(RefSeq) laminin, alpha 4
  KO
K06241  laminin, alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05143  African trypanosomiasis
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16775 (Lama4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16775 (Lama4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16775 (Lama4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16775 (Lama4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16775 (Lama4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16775 (Lama4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16775 (Lama4)
   05145 Toxoplasmosis
    16775 (Lama4)
   05143 African trypanosomiasis
    16775 (Lama4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 BORCS6 Sec34
Other DBs
NCBI-GeneID: 16775
NCBI-ProteinID: NP_034811
MGI: 109321
Ensembl: ENSMUSG00000019846
Vega: OTTMUSG00000034993
UniProt: P97927
Position
10 B1; 10 20.02 cM
AA seq 1816 aa
MGWSTAWCSVLALWLLWCAVCSNAASGDGNAFPFDIEGSAVVGRQDPSETSDSGVTLGRL
PPAAERCDAGFFRTLSGECAPCDCNGNSHECLDGSGFCLHCQRNTTGEHCEKCLDGYIGD
SIRGTPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYVGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARTAKNCAV
CNCGGGPCDSVTGECLEEGFEVPTGCDKCVWDLTDDLRLAALSIEESKSGLLSVSSGAAA
HRHVTDMNSTIHLLRTRLSERENQYTLRKIQINNSENTLRSLLPDVEGLHEKGSQASRKG
MLVEKESMDTIDQATHLVEQAHNMRDKIQEINSKMLYYGENQELGPEEIAEKLVLAQKML
EEIRSRQPFLTHRELVDEEADEAQELLSQAENWQRLHNDTRSLFPVVLEQLDDYNAKLSD
LQESINQALDHVRDAEDMNRAITFKQRDHEKQHERVKEQMEVVGASLSMSADSLTIPQLT
LEELDEIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEATDHAYNLQQEADELSRN
LHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYDAVSGIDTQIIYHKD
ESDNLLNQARELQAKADSSNDEAVADTSRRVGGALWRKGALRDRLNDAVKQLQAAERGDA
HQRLGQSKLFIEEANKTTAAVQQVTTPMANNLSNWSQNLQTFDSSAYNTAVDSARDAVRN
LTEVVPQLLDQLRTVEQKRPASNISASIQRIRELIAQTRSVASKIQVSMMFDGQSAVEVH
PKVSVDDLKAFTSISLYMKPPPKPAEPTGAWVADQFVLYLGSKNAKKEYMGLAIKNDNLV
YVYNLGMKDVEILLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGE
FAGDDSLLDLTPEDTVFYVGGVPANFKLPASLNLPSYSGCLELATLNNDVISLYNFKHIY
NMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEIRTPADN
GLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEISIIYHN
DKKMILVVDRRHVKSTDNEKKKIPFTDIYIGGAPQEVLQSRTLRAHLPLDINFRGCMKGF
QFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFNFRT
LQPNGLLFYYTSGSDVFSISLDNGTVVMDVKGIKVMSTDKQYHDGLPHFVVTSISDTRYE
LVVDKSRLRGKNPTKGKAEQTQTTEKKFYFGGSPISPQYANFTGCISNAYFTRLDRDVEV
EDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTNKQGEKSKDAPSWDPIGLKFL
EQKAPRDSHCHLSSSPRAIEHAYQYGGTANSRQEFEHEQGDFGEKSQFAIRLKTRSSHGM
IFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFIREKSSGRL
VIDGLRVLEERLPPSGAAWKIKGPIYLGGVAPGRAVKNVQITSVYSFSGCLGNLQLNGAS
ITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLVH
GHSVNGEYLNVHMRNGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITVIRDSNVVQLDV
DSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDSRPVSFSK
AALVSGAVSINSCPTA
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgggttggagcacagcttggtgctcagtcctggccctgtggctcctctggtgtgctgtc
tgctccaacgcagcgtcaggggacggcaatgcgtttccttttgacatcgaggggagcgca
gtggtcggcaggcaagacccatcggagactagcgactcaggcgtgacactgggacgcctg
ccgcctgctgctgagagatgtgacgctggattcttccgcacactgtcaggagaatgtgca
ccctgtgactgtaatggcaattcccatgagtgcttggatggctccggattctgtctgcac
tgccagcggaacacaacaggagagcactgtgaaaaatgtctggatggctatattggagac
tccatcagaggcacaccccggttctgccagccgtgcccctgtcccttgccccacctggcc
aactttgcagaatcctgctacaggaaaaatggagctgttcggtgtatttgtaaagaaaac
tatgttggacctaactgtgaaagatgtgctcctggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcggatcccaacctgatctttgaa
gactgtgatgaaatcactggccagtgcaggaactgcttacgaaataccaccggattcaag
tgtgaacgctgtgcacctggttactatggagacgccaggacagccaagaactgtgcagtg
tgcaactgtgggggcggcccgtgtgacagtgtaaccggagagtgcttggaagaaggattt
gaagtccctacaggctgtgataagtgcgtctgggacttgaccgatgacctgcgattagca
gcgctctccatcgaagagagcaaatccgggctgctgagcgtgtcctctggcgctgcggcg
catagacacgtgaccgacatgaactctaccatccacctcctcagaacaaggctgtcagaa
agagaaaaccagtataccctaagaaagatacagataaacaactcggagaacacactgaga
agcctcctgcctgatgtagagggactccatgagaagggaagtcaagcctcaagaaagggt
atgctggttgagaaggaaagcatggatacaattgaccaagcaacccatcttgtcgagcaa
gcccacaacatgagggacaaaatccaagagatcaacagcaagatgctctactatggagag
aatcaggaacttggccccgaggaaatagctgagaagctggtgttggcccagaaaatgctg
gaagagatccgaagccggcagccattcctcacccatcgggagctggtggatgaggaggca
gatgaggcccaggaattgctgagccaagctgagaactggcagcggctgcacaatgacacc
cgctctttattccccgtggtgctggagcagctggacgactacaacgctaagctgtccgac
ctccaggaatccattaaccaggccctcgaccatgtcagggatgcagaagacatgaataga
gccatcactttcaagcagcgggaccatgagaaacaacatgagagagtgaaggaacagatg
gaagttgtgggtgcctctctgagtatgtctgcagactctcttaccatacctcagctcact
cttgaggaacttgatgagataataaagaatgcatctggaatttatgcagaaatagatgga
gccaaaaatgagctgcaaggaaaactatccaacctgagtaacctcagtcatgacttggtt
caggaagctacggaccatgcatacaatcttcaacaggaagccgatgagctaagcagaaat
ttgcacagttcagacatgaacgggctggtacagaaggctttggatgcatcaaacgtctat
gaaaatatcgccaattatgtcagtgaagccaacgaaacagcagaacttgctctgaatatc
actgatcgaatttatgatgctgtgagtgggattgacacgcagatcatttaccataaggat
gaaagtgacaaccttctcaatcaagccagagagctgcaggccaaggcagattctagcaat
gatgaagcagtggctgacaccagcaggcgtgtgggtggagccctgtggaggaagggcgcc
ctcagagacagactgaatgatgctgttaagcaactacaggcagcagagagaggggacgcc
caccagcgcctgggccagtccaagctcttcattgaggaagctaacaagacgacagcggct
gtccaacaggttaccacaccaatggctaacaacctcagcaactggtcccagaacctgcag
acctttgactcatctgcatataacactgcagtggactctgctcgggacgcagtgagaaac
ctcaccgaggttgtcccccagcttctggatcagcttcgtactgtggagcagaagcggcct
gcaagcaacatttctgccagcatccagaggatccgagagctcattgctcaaaccaggagt
gtcgcaagcaagatccaagtctccatgatgtttgatggccagtcagctgtcgaagtgcac
cccaaagtcagtgtggatgacctgaaggccttcacatccatcagcttgtacatgaagcct
cctccaaagccggcagagcccactggggcctgggtagcagatcagtttgtcctctacctc
ggaagcaaaaacgccaaaaaagaatacatgggtctggcaatcaaaaatgataacctggta
tacgtttacaatttggggatgaaagatgtggaaattctcctggattccaagcctgtgagc
tcctggcccgcttactttagtattgtcaagattgaaagggtagggaaacacggaaaggtg
ttcttgacagtccccagtctcagtagcacagcagaagaaaagtttattaagaagggggag
tttgcaggagatgactccttgctggatctgacccctgaggacactgtgttttacgttggt
ggggtgcctgcgaacttcaagctccctgccagcttaaacctgcccagctactcaggctgc
ctagagctggccactctgaataatgatgtgatcagcttgtacaacttcaagcacatctat
aatatggatccatcaaagtcagtgccctgtgccagggataaactggctttcactcagagt
agggctgccagctacttcttcgatggctccagttatgcagtggtgagggacatcacgagg
agagggaagtttggtcaggtgactcgctttgacatagaaatccgaacaccagctgacaat
ggccttgtgctcctgatggtcaatggcagtatgtttttcagcctcgaaatgcgcaatggc
tacctacatgtgttctatgactttggattcagcaatggccccgtgcatcttgaagacacg
ttgaaaaaagcccagattaatgatgcgaaatatcatgagatctcaatcatttatcacaac
gacaaaaaaatgattttggtggtggacagacggcacgttaagagcacagacaatgagaag
aaaaagattcctttcacggacatctacatcggaggtgcgccccaagaagtcttacagtcc
aggaccctaagagcacaccttcccctagatatcaactttagggggtgcatgaaggggttc
cagttccaaaagaaagatttcaatttactggagcagacagaaaccctaggagttggttat
ggatgcccagaggactctctgatatctcgcagagcatatttcaatgggcaaagttttatt
gcttcaattcagaaaatatctttctttgatggctttgaaggaggcttcaatttccgaaca
ttacagccaaatgggttactattctactacacatcagggtcggacgtgttttccatttca
ctggacaacggcactgttgtcatggacgtaaagggcatcaaggtcatgtcaacagacaag
cagtaccacgatgggctgccccacttcgtggtcacctccatctcagacacaagatatgaa
ctggtagtagacaaaagccgacttcgagggaagaatccaacaaaagggaaggcagagcag
actcaaacaactgagaagaagttctactttggtggctcacccatcagtcctcagtatgct
aatttcactggatgtataagcaatgcctactttaccaggttggatagagatgtggaagtc
gaagacttccagcgctattctgaaaaggtccacacttcactctatgagtgtccgattgag
tcgtcacctctgtttctccttcacaaaaaaggaaagaattcctcaaagcctaaaacaaac
aaacagggagagaagagtaaggatgcgccttcatgggatcctattggcctgaagtttctg
gaacagaaagctccaagagattcccactgccacctctccagcagccccagggcaatagaa
catgcctatcaatatggcggcacggccaacagtcgccaggagtttgaacacgaacaagga
gattttggtgaaaaatcccagtttgccattcgtctgaagacccgttcctcacatgggatg
attttctatgtctcagaccaagaagagaatgatttcatgaccctgttcttggcccatggt
cgcttggtctttatgtttaatgttggccataagaaactgaagattagaagccaggagaaa
tacaatgatggattgtggcatgatgtgatatttattcgggaaaagagcagtggtcgactg
gtcattgatggtctacgagtcctagaagaaaggcttccccctagtggcgctgcctggaaa
atcaagggtcccatttatctgggaggagtggctcccggaagagccgtgaaaaatgtccag
attacctccgtctacagcttcagtggctgccttggcaatctccagctcaatggtgcctcc
atcacctccgcttctcaaacgtttagcgtgaccccttgctttgaagggccaatggaaaca
ggaacttatttttccacagaaggcggctatgtggttctagatgagtctttcaatattggg
ttaaaatttgaaattgcctttgaagtccgcccccggagcagttctggaacccttgtccat
ggccacagcgtcaacggggaatacctgaacgtgcacatgagaaacggacaggtcatagtg
aaggtcaacaacggtgtcagagacttttctacctcagtaactcccaagcagaatctctgt
gatggcagatggcacagaattacagttattagagattcaaacgtggttcagttggatgta
gactcagaagtgaaccatgtagttgggccgttgaatccaaagccagttgatcacagggag
cctgtgtttgttggaggtgttccagagtctttactgacaccacgtttggctcccagcaaa
cccttcaccggctgcatccgccactttgtaattgacagccgccctgtgagcttcagtaaa
gctgccctggtcagtggtgctgtgagcatcaactcctgtcccacagcctga

KEGG   Mus musculus (mouse): 16776
Entry
16776             CDS       T01002                                 

Gene name
Lama5, AA408760, AA408762, AI853660, [a]5, laminin-511, mKIAA0533
Definition
(RefSeq) laminin, alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16776 (Lama5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16776 (Lama5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16776 (Lama5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16776 (Lama5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16776 (Lama5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16776 (Lama5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16776 (Lama5)
   05145 Toxoplasmosis
    16776 (Lama5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_II Laminin_G_1 Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 16776
NCBI-ProteinID: NP_001074640
MGI: 105382
Ensembl: ENSMUSG00000015647
Vega: OTTMUSG00000016271
UniProt: Q61001 Q3TZ05
Structure
PDB: 
2Y38

Position
2 H4; 2 102.7 cM
AA seq 3718 aa
MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGGDGFSLHPPYFNLAEG
ARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAH
PVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERS
TDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLV
NGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDIS
IGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANE
CQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFFRA
PDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYPLP
SFPHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFRGAHCELCAPGFH
GPSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQLCGCSPAGT
LPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGALDQQCGVGGLCHCRP
GYTGATCQECSPGFYGFPSCIPCHCSADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVPGA
YNFPYCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCT
RCSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRSCRCDVGG
ALGQGCEPKTGACRCRPNTQGPTCSEPAKDHYLPDLHHMRLELEEAATPEGHAVRFGFNP
LEFENFSWRGYAHMMAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQISVREEGKLS
SCTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLDYVVLLPS
TYYEAALLQHRVTEACTYRPSALHSTENCLVYAHLPLDGFPSAAGTEALCRHDNSLPRPC
PTEQLSPSHPPLATCFGSDVDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAP
QQGVLNLHPCPYSSLCRSPARDTQHHLAIFYLDSEASIRLTAEQAHFFLHSVTLVPVEEF
STEFVEPRVFCVSSHGTFNPSSAACLASRFPKPPQPIILKDCQVLPLPPDLPLTQSQELS
PGAPPEGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLLHGYQPVHPSFPV
EVLINGGRIWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWLDY
VLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSPFCRNAATSLSLFYNNGA
LPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELT
GQCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPN
VAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHCKENVQGSRCDQCRVGTF
SLDAANPKGCTRCFCFGATERCGNSNLARHEFVDMEGWVLLSSDRQVVPHEHRPEIELLH
ADLRSVADTFSELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDIFIPYESRPDVVLQG
NQMSIAFLELAYPPPGQVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALF
SQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLG
RCVPCQCHGHSDRCLPGSGICVGCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLA
VPSNNFADGCVLRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPN
MIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNALLPGNCTRCDCSPCGTETCDPQSG
RCLCKAGVTGQRCDRCLEGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQ
CLECAPGYWGLPEKGCRRCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPG
GHGIHCEVCDHCVVLLLDDLERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQSK
LRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQATGVQGQAGQLLDTTESTLGRAQKL
LESVRAVGRALNELASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVA
EAELAEAQRLMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREA
EELNSRNQERLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKEDLEHLA
ASLDGAWTPLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIILGINQDRFIQRA
VEASNAYSSILQAVQAAEDAAGQALRQASRTWEMVVQRGLAAGARQLLANSSALEETILG
HQGRLGLAQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAE
ALSTATHVQSQLQGMQKNVERWQSQLGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLS
RLENRGVHNASLALSANIGRVRKLIAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAA
YTALKFHIQSPVPAPEPGKNTGDHFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPT
TLSIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVF
YVGGYPSNFTPPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATG
DPWLTDGSYLDGSGFARISFEKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQEG
TLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQDNM
LEMADAYYLGGVPPEQLPLSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCT
ADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPYQVSL
REGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTTPMLQL
QPEEPSRLLLGGLPVSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQ
LIETSRATAQKVSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGISPSHRNR
LHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRA
GQWHRVSVRWGMQQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLPASSYSSKLP
VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLELPKAKMPY
VSLELEMRPLAAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFSTWVTYPKLCDG
RWHRVAVIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKSSTARPELPAYRG
CLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH
NT seq 11157 nt   +upstreamnt  +downstreamnt
atggcgaagcgcggagggcagctctgcgcggggagcgcaccgggcgctcttggcccccgg
agccccgcgccacggccgctgctactgctgctggctggactggcgctggtaggcgaggcg
cgcactcccgggggcgatggcttcagcctgcacccgccctacttcaacctggcggagggc
gctcgcatcaccgcgtccgcgacctgcggcgaggaggccccgacgcgcagtgtctcacgc
cccaccgaggacctctactgcaagctggttgggggtccggtggctggcggagatcccaat
cagacaatccagggccagtactgtgacatctgtacagctgccaacagcaacaaggcacac
cctgtgagcaacgccatcgatggcacggagcgctggtggcagagcccacccctgtcccgt
ggcctggagtacaatgaggtcaacgtcacactggacctgggccaggtgttccatgtggcc
tatgtgctcatcaagtttgccaactcacctcggcctgacctctgggtgctggagcggtcc
acagacttcggtcacacttatcagccgtggcagttctttgcctcctccaagagggattgt
ttggagcggtttggacctcggactctagagcgcatcacgcaggacgacgacgtcatctgc
accacagaatactcgcgaatagtgcctttggagaatggcgagattgtggtgtccttggta
aatgggcgccctggggccttgaacttctcctactcaccgttacttcgagacttcaccaaa
gccaccaacatccgcttgcggtttctgcgaaccaacacgctactgggccacctcatgggc
aaggcgctgcgggaccccacagtcacccgcaggtattattacagcatcaaagacatcagc
attggtgggcgctgtgtctgtcatggccacgcagatgtctgtgacgccaaggacccattg
gatcctttcaggctgcagtgtgcctgccagcacaatacatgtggaggctcttgtgaccga
tgctgtccaggcttcaaccagcagccgtggaagcccgccaccacggacagcgccaatgag
tgccagtcctgcaattgccacggccatgcctacgactgttactacgaccctgaggtggat
cggcgcaatgccagccagaaccaggacaacgtgtaccagggtggaggtgtctgcctggat
tgccagcatcacactacgggtatcaactgtgagcgttgtctgcctggcttcttccgtgcc
cctgaccagcctctcgactcacctcatgtctgtcggccctgcgactgtgagtcagacttc
acggatgggacctgtgaagacttgacgggccgctgttactgcaggccgaacttcacagga
gagctatgtgctgcctgcgctgagggctacacggacttcccacactgctaccctctgcct
tcatttccccacaatgacacgagagaacaggtgcttcccgctggacaaatcgtgaactgt
gattgcaatgctgcagggacccagggcaatgcctgccggaaggacccaaggttgggacgg
tgtgtctgcaaacccaacttccggggtgcccactgtgagctctgtgctcctggattccac
gggcctagctgccacccatgccagtgttccagccctggggtagccaacagcctctgtgac
ccagagtctggccagtgcatgtgccgcaccggctttgagggggacaggtgtgaccactgt
gcccttggctatttccacttccctctctgtcagctgtgtggctgcagcccagcagggacc
ttgcctgaaggctgtgacgaggctggccgctgccagtgccgacctggctttgacggtcct
cactgtgaccgatgccttccaggataccatgggtatcccgactgtcacgcttgtgcctgt
gaccctcggggggccctggatcagcagtgtggagtgggcggtttgtgccactgccgtcct
ggctacacaggtgccacttgtcaggaatgtagccccggcttctacggcttccccagctgc
atcccctgccactgctctgccgatggctccttgcatacaacctgtgacccgacaaccggc
cagtgtaggtgtcgaccccgagtgacaggactacattgtgatatgtgtgtaccaggcgcc
tataacttcccctactgtgaagctggctcttgtcatcctgctggtctggccccagccaat
cctgcccttcctgagacacaggctccctgtatgtgccgggctcacgtggaagggccaagc
tgtgatcgctgtaaacctgggtactgggggctgagcgccagcaaccctgaaggctgcaca
cgctgcagctgtgacccacgaggcaccctgggtggagttactgagtgccagggcaatggg
cagtgcttctgcaaggctcacgtgtgtggcaagacctgtgcagcctgcaaggatggcttc
tttggcctggattatgctgactactttggctgccgtagctgtaggtgtgatgttggtggt
gccctgggtcaaggctgtgaaccaaagacaggtgcctgcaggtgccgccctaacacccaa
ggacccacctgtagcgagccagcgaaggaccactacttgccagacctgcaccacatgcgg
ctggaactagaggaggcggccactcccgagggccacgctgtacgctttggcttcaacccc
ctggagtttgagaactttagctggagaggctacgcacacatgatggctatccagcccagg
attgtggccaggctgaacgtgacctcccctgacctctttcggctggttttccgatatgtc
aaccgtggatcaaccagcgtgaatgggcagatctctgttcgtgaagagggcaagctttcc
agctgtaccaactgcacagagcagagccagccagtggctttcccacccagcactgagcct
gcctttgtcactgtgccccagaggggctttggggaaccctttgtgctgaaccccggcatc
tgggccttgctggtcgaggctgaaggtgtactcttggactacgtggtcctactgcccagc
acctactatgaggcagctctcctacagcatcgagtaacggaggcctgtacctaccgtccc
tcagccctgcactccacagagaactgtcttgtctatgctcacctacccctggatggcttc
ccttcagcagctggaactgaggccctgtgtcgccatgacaacagcctgccccggccctgc
cccacagagcagctcagcccctcacacccaccgctggcgacctgcttcggcagtgatgtg
gacatccagctcgagatggccgtgcctcagcctggccaatatgttctcgtggtggaatat
gtcggtgaggattcacaccaagagatgggagtggctgtgcacacccctcagagagccccc
cagcaaggggtgctcaacctccacccctgcccatacagctccctgtgccggagtccggct
cgggacacccagcatcatctagccatcttctacctggactctgaggctagcatccggctc
acagctgagcaagctcacttcttcctgcacagcgtcaccctggtacctgtggaggagttc
agtactgagtttgtggagccccgggtcttctgtgtgagcagtcatggaactttcaacccc
agcagtgctgcctgtctagcctcccgattcccgaagccaccgcagcccatcatccttaag
gactgccaggtcttgccgctgcctcccgacctgcctctgactcagtctcaggagctctca
ccaggtgcaccccccgagggaccacagcctcggccgccaactgcggtggatcctaatgca
gaacccaccttgctgcgccacccccagggcacggtggtcttcaccacccaggtgcccacc
ctgggccgctatgcctttctgctgcacggctaccagccggtccacccctccttccctgtg
gaggtactcattaatggtggccgcatctggcagggccacgccaacgccagcttttgtcct
catggttatggctgccgtaccctggtgttgtgtgagggtcagacgatgctggatgttaca
gacaacgagctcaccgtgactgtgcgtgtgccagaaggccggtggctctggctggactac
gtactcattgtccctgaggatgcttacagctccagttacctccaagaggagcctttggac
aaatcctatgacttcatcagccactgtgccacccagggctaccacattagccccagcagc
tcatctccattctgccggaatgccgccacctccttgtctctcttctacaacaacggggcc
ctcccttgtggctgccacgaggtgggtgccgtaagccccacgtgcgagcccttcgggggc
cagtgtccctgccggggccacgttattggccgtgactgttcccgctgtgccaccggctac
tggggtttccccaactgcaggccctgtgactgtggagcccgcctgtgtgacgagctcacg
ggccagtgtatctgtccaccacgcactgttccccctgactgcttggtctgccagccacag
agctttggttgccaccccttggtgggctgtgaggagtgtaactgctcagggcccggcgtc
caggagctgacggaccctacctgtgacatggacagcggccagtgcagatgcagacccaat
gtagctggacgtcgctgtgatacctgtgccccgggcttctatggctatcctagctgtcgc
ccctgtgactgccatgaggcaggcaccatggctagcgtgtgtgaccccctcacaggccaa
tgccattgcaaggagaacgtgcagggctcaagatgtgaccagtgtcgcgtggggaccttc
tccttggatgctgctaaccccaagggctgtacccgctgcttctgtttcggggccacagag
cgctgtgggaactctaacctcgcccgccatgagttcgtggacatggagggctgggtgctg
ttgagcagtgaccggcaggtggtaccccacgagcatcggcctgagatagagctgctgcac
gcagatctgcgctctgtggctgacactttctcagagctgtactggcaggctccgccctcc
tatctgggagacagggtgtcatcctacggtggaaccctccactatgagctgcactcagag
acccagcgaggtgatatcttcattccctacgagagccggccggacgtcgtgctgcagggc
aaccaaatgagcatcgccttcctggaactggcgtaccctccgcctggccaggttcaccga
ggacagctacagctggtagaggggaacttccggcacttggagactcacaaccccgtgtcc
cgagaagaactcatgatggtgctggccggcctggagcagctgcagatccgtgctctcttc
tcgcagacctcttccagtgtctccttgcgtagagtggtactggaggtggctagcgaggct
ggtagggggcctccagccagcaatgtggaactgtgtatgtgccctgccaactaccgtggg
gactcgtgccaggaatgtgcccctggctattaccgggacaccaagggtctcttcctaggc
cgatgtgtcccctgtcagtgccatggccattcagatcgctgccttcctggctctggcatt
tgtgtgggctgccagcacaacacagaaggggaccaatgtgagcgctgtaggcctggcttt
gtcagcagtgatcccagtaaccctgcatccccatgtgtgagctgcccttgccccttggca
gtgccctccaataattttgcagacggttgcgtcttaagaaatggccgaacccagtgcctc
tgcaggccaggctatgctggtgcctcctgcgagcggtgtgcacctggcttttttgggaac
cccctggtgctaggcagctcctgtcagccctgcgactgcagcggtaatggagaccccaac
atgatcttcagtgactgcgaccccctgacgggtgcctgtcgaggctgcctccgtcacacc
actgggccccactgtgaacgctgtgccccaggcttctatggcaatgctttgttgccaggc
aactgcacccggtgtgactgttccccatgtgggacagaaacctgtgatccccagagtgga
cgctgcctgtgcaaagcaggcgtgactggacaacgttgtgaccgctgtttggaaggatac
ttcggttttgagcaatgccagggctgccgcccttgtgcctgtggaccagctgccaagggc
tccgagtgccaccctcagagcggtcagtgtcactgccagccagggaccacaggaccccag
tgcctcgagtgcgcccctggctactggggcctcccagagaagggctgcaggcgctgccag
tgtccccgaggccactgtgacccacacacgggccactgcacctgtcccccggggctcagc
ggggaacgctgtgacacctgcagccagcagcaccaggtgcctgtaccgggcaagcctggg
ggccatggcatacactgtgaagtgtgtgaccactgtgtggttctccttctggatgacctc
gagcgggctggtgccctcctccccgctatccgtgagcagctgcagggtatcaatgccagc
tccgcggcctgggccaggctgcacaggctgaatgcctccattgctgacctgcagagtaaa
ctccggagcccaccgggaccccgctaccaggcagcacagcagctacagactctagagcag
cagagtataagccttcaacaggacacggagaggctgggcagtcaggccacaggggtccaa
ggtcaggcaggccagctactggacaccacagagtccacactgggccgggcacagaagttg
ttggagtctgtgcgagctgtgggccgtgccctgaatgagctggcatctcgcatgggccaa
ggatctccaggcgatgccttggtaccgtctggcgagcagctgcgctgggctctggctgaa
gtggagcggctgctctgggatatgcggacgcgtgacctgggggcccagggggcagtggca
gaggccgaactggccgaagcccagaggctgatggctcgtgtccaggagcagctgaccagc
ttctgggaggagaaccagtcattggccacacacattcgggaccagctggctcagtatgag
tctggcctcatggatcttcgtgaggccctgaaccaggccgttaataccacccgggaggct
gaggaactcaacagccgcaaccaggaacggctgaaggaagccctgcaatggaaacaggaa
ctgtcccaggacaatgccaccctgaaggccactcttcaagctgccagtctcatcttgggc
catgtttctgagcttctgcagggcatagaccaggctaaggaggacctagagcacctggcg
gccagcctggatggagcctggacacccttactgaagaggatgcaggccttttcccctgcc
agcagcaaggtggacttggtagaggctgctgaggcccacgctcagaagctgaaccagctg
gcaatcaacctgtctggcatcatccttggcatcaatcaggaccgcttcatccagagggct
gtggaagcctccaatgcctacagcagcatccttcaggccgttcaggctgccgaggatgcg
gcaggccaggcactgaggcaggccagccgcacatgggagatggtggtgcagcggggccta
gcagctggagcccggcagctgttagccaacagcagtgccctggaggagaccatccttgga
caccaggggaggctgggccttgctcagggccgtctgcaggctgcggggatccagcttcat
aatgtctgggccaggaagaaccagctagcagcccagatccaggaggcacaagccatgctg
gccatggacacgagcgagaccagtgagaagattgctcacgccaaggctgtggctgccgaa
gccctcagtacggccacccacgtgcagtctcagcttcagggtatgcagaagaatgtggag
aggtggcagagccagctgggaggcctgcaaggccaggacctgagccaggtggaacgggat
gcaagcagttcagtgtccaccctggagaagacattgccacagctgctggccaaactgagc
cgtctagagaaccgtggagttcacaatgccagcctggctttgtctgccaacattggtcgt
gtgcgcaagctcattgcccaagcccggagtgccgccagcaaggtcaaggtgtccatgaag
ttcaatgggcgttcaggggtacgactgcgtaccccacgagaccttgccgaccttgctgcg
tacactgccctcaagttccacatccagagcccagtgccagcgcccgaacctggcaagaac
acgggggaccactttgttctgtacatgggcagccgccaggccactggggactacatggga
gtgtctctgcgtaatcagaaggtgcactgggtgtacaggctaggaaaggctggccccaca
actctcagcatcgacgagaacatcggggagcagtttgcagccgtcagcatcgacaggacc
ctccagtttggccacatgtctgtcaccgtggagaaacagatggttcatgagatcaaggga
gacacggtggcccctgggagcgagggactactcaacctgcatcctgacgattttgtcttc
tacgtgggaggataccccagcaacttcacgccccctgaacccctccgattccctggctac
ctgggctgcattgagatggaaacactgaatgaggaggtggtcagcctctacaattttgag
cagaccttcatgctggacacggcagtagataaaccttgtgctcgctccaaggccaccggt
gacccatggctcacagatggctcctacctggatggcagtggctttgcccgcatcagcttt
gagaagcagttcagcaacacaaaacgctttgaccaggagctgcggcttgtgtcctacaat
gggatcatctttttcctcaagcaagagagccagttcttgtgcctggcagtgcaggaaggc
accctggtgctcttctatgacttcggctctggcctgaagaaggccgacccactgcagccc
ccacaagccttgacggcagccagcaaggcgatccaagtgtttctattggctggcaatcgc
aaacgtgtgttggtgcgtgtggagcgggccactgtgttcagcgtagaccaggataacatg
ctggagatggctgatgcctactacttgggaggtgtgccacctgaacagctgcccttgagc
ctacggcagctcttcccctccggaggctctgtccgtggctgcatcaagggtattaaggct
ctgggcaagtacgtggacctcaaacggttgaacaccacgggcatcagtttcggctgcacc
gctgacctgctagtgggacgcaccatgacttttcacggccacggcttcctgcccctggca
cttcctgatgtggcacccatcaccgaagtggtctattctggctttggctttcgtggcacc
caggacaacaacctgctgtattaccgtacctccccggatgggccgtaccaggtatccctg
agggagggccacgtgacactccgttttatgaaccaagaggtggaaactcaaagggtcttt
gctgatggtgctcctcactatgttgccttctatagcaatgtcacaggggtatggctgtat
gtggatgaccagctacaactagtaaagtctcatgagagaacaactcccatgctccaacta
cagcccgaggaaccctcacggcttctcctgggaggcctgcctgtgtctggtaccttccac
aacttcagtggctgcatcagcaatgtttttgtacagcgacttcggggaccacagcgtgtg
tttgacctacaccagaacatggggagtgtcaatgtaagcgtaggctgtacaccagcccaa
ctcatcgagacctcaagggccacggctcagaaggtttcccgccgtagtcgacaacccagc
caggaccttgcctgcacgacaccctggctccctgggactattcaggatgcataccagttt
gggggacccctgcccagttacctacagtttgtgggtatctctccgtcccacaggaatagg
ctccacctctccatgcttgtccgtccacatgcggcttcccagggcctcctgctctctaca
gcccccatgtcgggccgcagcccttcgttggtactctttctaaaccatggacactttgtc
gcacagactgagggccctgggccccggctccaggtccagagtcgccagcactcacgggct
ggccagtggcacagggtgtccgtccgctggggaatgcagcagatccagcttgtggtggac
ggcagccagacctggagccagaaggctctccaccatcgggtccccagggcagagcgacca
cagccctacaccctctctgtaggaggtcttcctgccagcagttacagttccaagctccct
gtgtctgtggggttcagcggctgtctgaagaaattacagctggataagcggccactgagg
accccaacgcaaatggtgggggtcacaccctgtgtctcaggccccctggaagatggcctg
ttcttcccaggcagtgagggagttgtcacattagagctccccaaggccaagatgccctat
gtgagcctggagctagagatgcggcccttggcagctgctggcctcatcttccacctgggc
caggccctggccactccctacatgcagctgaaggtgctgacagaacaggtcctgctgcag
gcaaatgatggggcaggggagttttccacgtgggtgacctaccccaagctttgtgatgga
cggtggcaccgagtggcagtgatcatgggcagggacacactccggctggaggtagacaca
cagagcaaccacaccacaggccgtttgccagagagcttggctggttctccagcacttctg
cacctcgggagcctgcccaagtcttcaactgctcggccagagctccctgcctaccgagga
tgcttgaggaagctgctgatcaatggggcccctgtcaacgtgactgcttctgtacaaatc
cagggggcagtggggatgcgcggatgcccctcaggaaccctagcactttccaagcaggga
aaggcactgacccagaggcaggccaagcccagtgtctccccgctactttggcattga

KEGG   Mus musculus (mouse): 16777
Entry
16777             CDS       T01002                                 

Gene name
Lamb1, C77966, C80098, C81607, D130003D08Rik, Lamb, Lamb-1, Lamb1-1
Definition
(RefSeq) laminin B1
  KO
K05636  laminin, beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16777 (Lamb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16777 (Lamb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16777 (Lamb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16777 (Lamb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16777 (Lamb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16777 (Lamb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16777 (Lamb1)
   05145 Toxoplasmosis
    16777 (Lamb1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C HU-CCDC81_bac_2
Other DBs
NCBI-GeneID: 16777
NCBI-ProteinID: NP_032508
MGI: 96743
Ensembl: ENSMUSG00000002900
Vega: OTTMUSG00000035464
UniProt: E9QN70 Q3UHL7
Structure
PDB: 
5MC9 4AQS

Position
12 A2; 12 13.39 cM
AA seq 1786 aa
MGLLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGG
VCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVG
LIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCY
CKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQC
NEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFF
IDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGG
SGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQC
HCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDA
LRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTG
CGPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKF
LEKAKALKISGVIGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDV
TEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDS
ITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDE
LAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDL
RNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVI
LQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVK
QNADDVKKTLDGELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLL
EDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atggggctgctccaggtgttcgcctttggtgtcctagccctatggggcacccgagtgtgc
gctcaggaaccggagttcagctatggctgcgcagaaggcagctgctaccctgccactggc
gaccttctcatcggccgagcgcaaaagctctccgtgacttcgacatgtggactgcacaaa
ccagagccctactgtattgttagccacctgcaggaggacaagaaatgcttcatatgtgac
tcccgagacccttatcacgagaccctcaaccccgacagccatctcattgagaacgtggtc
accacatttgctccaaaccgccttaagatctggtggcaatcggaaaatggtgtggagaac
gtgaccatccaactggacctggaagcagaattccatttcactcatctcatcatgaccttc
aagacattccgcccagccgccatgctgatcgagcggtcttctgactttgggaaggcttgg
ggcgtgtacagatacttcgcctacgactgtgagagctcgttcccaggcatttcaactgga
cccatgaagaaagtggatgacatcatctgtgactctcgatattctgacattgagccctcg
acagaaggagaggtaatatttcgtgctttagatcctgctttcaaaattgaagacccttat
agtccaaggatacagaatctattaaaaatcaccaacttgagaatcaagtttgtgaaactg
cacaccttgggggataaccttttggactccagaatggaaatccgagagaagtactattac
gctgtttatgatatggtggttcgagggaactgcttctgctatggccacgccagtgaatgc
gcccctgtggatggagtcaatgaagaagtggaaggaatggttcacgggcactgcatgtgc
agacacaacaccaaaggcctgaactgtgagctgtgcatggatttctaccacgatttgccg
tggagacctgctgaaggccggaacagcaacgcctgcaaaaaatgtaactgcaatgaacat
tccagctcgtgtcactttgacatggcagtcttcctggctactggcaacgtcagcggggga
gtgtgtgataactgtcagcacaacaccatggggcgcaactgtgaacagtgcaaaccgttc
tacttccagcaccctgagagggacatccgggaccccaatctctgtgaaccatgtacctgt
gacccagctggttctgagaatggcgggatctgtgatgggtacactgatttttctgtgggt
ctcattgctggtcagtgtcggtgcaaattgcacgtggagggagagcgctgtgatgtttgt
aaagaaggcttctacgacttaagtgctgaagacccgtatggttgtaaatcatgtgcttgc
aatcctctgggaacaattcctggtgggaatccttgtgattctgagactggctactgctac
tgtaagcgcctggtgacaggacagcgctgtgaccagtgcctgccgcagcactggggttta
agcaatgatttggatgggtgtcgaccttgtgactgtgaccttggaggggcgctgaacaat
agctgctccgaggactccggccagtgctcctgcctgccccacatgattgggcggcagtgt
aacgaggtggagtccggttactacttcaccaccctggaccactacatctacgaagccgag
gaagccaatctggggcctggagtcattgtggtggaaaggcagtacattcaggaccgcatt
ccttcctggacaggacctgggttcgtccgggtgcctgaaggggcttatttggagtttttc
attgacaacataccgtattccatggagtatgaaatcctgattcgctatgagccacagctg
ccggaccactgggagaaagctgtcatcactgtacagcggccggggaagattccagccagc
agccgatgtggtaacaccgttcccgatgatgacaaccaggtggtgtccttgtcaccgggc
tcaagatacgttgtcctccctcgccccgtgtgctttgagaagggaatgaactacacggtg
aggttggagctgccccagtatacggcatcgggcagtgacgtggagagcccttacacgttc
atcgactcgcttgttctcatgccctactgtaaatcgctggacatcttcactgttggcggc
tcaggcgatggggaggtcaccaatagtgcctgggaaaccttccagcgctacaggtgtctg
gagaacagcaggagtgtggtaaaaacacccatgacagatgtctgcagaaacattatcttc
agcatttctgccttgattcaccagacgggccttgcttgtgaatgtgacccccagggatct
ctgagttctgtgtgtgaccccaatggtggccagtgccagtgccgtcctaatgtggttgga
agaacctgcaacaggtgtgccccgggcacctttggctttggccccaacggatgcaaacct
tgtgactgccatctgcaagggtctgccagtgccttctgcgatgcgatcactggccagtgc
cactgtttccagggcatctatgctcggcagtgtgaccgatgtctccctgggtattggggc
tttcccagctgccagccctgccagtgtaatggtcatgctctagactgtgacacagtgaca
ggggagtgtctgagctgtcaggactacaccacgggccacaactgcgaaaggtgcctggct
ggctactacggtgatcccatcattgggtcaggagaccactgtcgcccttgcccttgtcct
gatggtcctgacagtggacgacagtttgccaggagctgttatcaagaccccgtcactctc
cagcttgcgtgtgtttgtgatcctgggtacattggctccagatgtgatgactgtgcctct
ggattttttggcaatccctcagactttgggggttcatgtcaaccatgtcagtgccaccac
aacattgacactaccgatccagaagcctgtgacaaggagacgggacgatgcctcaagtgc
ctgtaccacacagaaggggaccattgccagctctgccagtatgggtactacggcgatgct
cttcggcaagactgtagaaagtgtgtctgcaattacctgggcacggtgaaggaacattgt
aatggctctgactgccactgtgacaaagccactggtcagtgctcgtgccttcccaatgtg
atcgggcagaactgtgaccggtgtgcgcccaacacctggcagctggctagcgggactggc
tgcgggccctgcaattgcaatgctgcgcattcctttgggccatcctgcaacgagttcaca
gggcagtgccagtgcatgccgggctttggaggccgaacctgcagcgagtgccaggagctc
ttctggggagaccctgatgtggaatgccgagcctgtgactgtgatcccaggggcattgag
acacctcagtgtgaccagtccacgggccagtgtgtctgtgtggagggtgtagagggtcct
cgctgcgacaagtgcaccagaggttactcgggggtctttcctgactgcacaccctgccac
cagtgctttgctctctgggatgctatcattggtgagctgaccaacaggacccacaaattc
ctggagaaagccaaggctctgaaaatcagtggtgtgattggtccctaccgagagaccgtg
gactctgtagagaagaaagtcaatgagataaaagacatcctggcccagagcccagcagcg
gaaccactgaaaaacattggcattctcttcgaggaggcagagaaactaaccaaagatgtc
acagaaaagatggcgcaggtagaagtgaaattaactgatacagcttcacagagtaacagc
acagctggagagctcggcgcactgcaggcagaagcagagagccttgacaagaccgtgaag
gagctggcagaacagctggagtttatcaaaaactccgatattcagggcgccttggatagc
atcaccaagtatttccagatgtctcttgaggcagagaagcgggtgaatgcctccaccaca
gaccccaacagcactgtggagcagtctgccctcacgcgagacagagtagaagatctgatg
ttggagcgagagtctccgttcaaggagcagcaggaggaacaggcacgcctcctggacgaa
ctggccggcaaactgcaaagtctcgacctgtcggctgttgcacagatgacctgtggaaca
cctccaggggctgactgttctgaaagtgaatgtggtggccccaactgcagaactgacgaa
ggagagaagaagtgtggggggcctggctgtggtggtctggtcactgtggcccacagtgct
tggcagaaagccatggattttgaccgtgatgtcctgagtgccctggctgaagtcgaacag
ctctccaagatggtctctgaagcaaaagtgagagcagatgaggcgaagcagaatgcgcag
gatgtcctgttaaaaacaaatgctaccaaagaaaaagtggacaagagcaacgaggacctg
cggaacctcatcaagcagatcagaaacttcctgactgaggatagtgctgatctagacagt
attgaagcagttgctaatgaagtactgaaaatggaaatgcctagcacgccacagcagtta
cagaacctaacagaagacattcgggagcgagttgaaaccctctctcaagtagaggttatt
ttgcagcagagtgcagctgacattgccagagctgagctgttgcttgaggaagctaagaga
gcaagcaaaagtgcaacagatgttaaagtcactgcagacatggtgaaggaagcattagaa
gaagcagaaaaggcccaggttgcagcagagaaggcgattaaacaagctgatgaggatatc
caaggaacccaaaacctgctaacatcgattgaatctgaaacggcagcttctgaggaaacc
ctgaccaacgcctcccagcgcatcagcaagcttgagaggaacgtggaagagcttaagcgt
aaagctgcccagaactctggggaggcagaatatatcgaaaaagtagtatattctgtaaaa
cagaatgcagacgatgttaagaagactctagatggcgaacttgatgaaaagtataagaag
gtagaaagtttaattgcccaaaaaactgaagagtcagcagatgccaggaggaaagctgag
ctgctacaaaatgaagcaaaaacactcttggctcaagctaacagcaagctccagctgttg
gaagacttagaaagaaaatatgaggacaatcaaaaatacttagaagataaagctcaagaa
ttggtgcgactggaaggagaggttcgctccctccttaaggacataagtgagaaagttgcg
gtttacagcacctgcttataa

KEGG   Mus musculus (mouse): 16779
Entry
16779             CDS       T01002                                 

Gene name
Lamb2, AW211941, L, Lamb, Lamb-2, Lams, np, npht
Definition
(RefSeq) laminin, beta 2
  KO
K06243  laminin, beta 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16779 (Lamb2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16779 (Lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16779 (Lamb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16779 (Lamb2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16779 (Lamb2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16779 (Lamb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16779 (Lamb2)
   05145 Toxoplasmosis
    16779 (Lamb2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 16779
NCBI-ProteinID: NP_032509
MGI: 99916
Ensembl: ENSMUSG00000052911
Vega: OTTMUSG00000050824
UniProt: Q61292 Q3USI2
Position
9 F2; 9 59.4 cM
AA seq 1799 aa
MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGP
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELMVQRPGPVSAHSPCGHV
LPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRAQPETSYSGLLIDSLV
LQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLLISVSALIYNG
ALPCQCDPQGSLSSECSPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGAL
SALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDY
TGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREG
YTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHC
GYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHC
APNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ
CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNMQGKLGMVQAIMSARNASAASTAKLV
EATEGLRHEIGKTTERLTQLEAELTAVQDENFNANHALSGLERDGLALNLTLRQLDQHLE
ILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENF
NRQHLANQQALGRLSAHAHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGG
LGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKAN
ASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEI
AERVRSLADVDTILAHTMGDVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQG
AAQGAIWGAVVDTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSL
AASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEAR
DLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5400 nt   +upstreamnt  +downstreamnt
atggagtgggcctcaggagaaccagggaggggcaggcagggacagcctttgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaggccccgtccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcggacagactgacggcctcatccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggacgaaaagaagtgtttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcatcggatccagaatgtagtcaccagctttgcgcca
caacgccggacagcctggtggcaatcggagaacggggttccaatggtcaccatccaactg
gacctggaagctgagtttcatttcacccacctcattatgacgttcaagacgttccggcct
gctgctatgctggtggagcgttctgcagactttggccgcacctggcacgtgtaccgatat
ttttcctatgactgcggggctgacttcccgggaatcccactggccccgccacgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaatcgagccgtctacggaaggcgaggtc
atctatcgtgtgctggaccctgctattcctatcccagacccctacagctcacggattcag
aacctgttgaagatcaccaacctacgagtgaacttaacccggcttcacacactgggagac
aacttgcttgacccacggagggagatccgggaaaaatactattatgctctctatgaactt
gtcatccgtggcaactgcttctgctatggccacgcctcacagtgtgcgcctgcaccaggg
gcgccggcccatgctgagggcatggtacacggagcctgtatctgcaagcacaatactcgt
ggactcaactgtgagcagtgtcaggatttctatcaggaccttccctggcaccctgcagag
gacggccatactcacgcctgtcggaagtgtgagtgcaacgggcatactcatagctgccac
tttgacatggctgtctacctggcatctggaaatgtaagtggaggcgtatgcgatgggtgt
cagcacaacacagctgggcgccattgtgagttctgccggcccttcttctaccgtgacccc
accaaggacatgcgggacccagctgtgtgccgtccttgtgactgtgaccctatgggttct
caagatggtggtcgctgtgattctcatgatgaccctgtgctaggactggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgtgatggcttcttt
ggacttagtgccagtgaccctcgagggtgccagcgttgccagtgtaattcacggggcaca
gtgcctgggagctccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
accggacatggctgtgaccgctgtctgcctggccactggggcctgagccatgacctgctg
ggctgccgtccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaggcc
accggtcagtgccgctgccgccaacacatgattgggcggcgctgcgaacaagtgcagcct
ggctacttccggccttttctggaccatttaacctgggaggctgaggctgcccaagggcag
gggcttgaggtggtagagcggctggtgaccaaccgagagactccgtcctggactggccca
ggctttgtgcggctgcgagaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggtccctgagcaatgggcagag
ctggaactgatggtgcagcgtccggggcctgtgtctgctcacagtccgtgcgggcatgtg
ctgcctaaggatgaccgcattcaggggatgcttcacccaaacaccaggtttttggtgttt
cccagacctgtctgccttgagcctggcatctcctacaagctgaagctgaaactgatcgga
acagggggacgagcccagcctgaaacctcctactctggattactcattgactcgctggtc
ctgcagccccacgtcttggtgctagagatgtttagtgggggcgatgctgctgctctggag
cgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagcaaggcc
cctctatctgagacctgtgcccccctcctcatcagcgtgtccgccttgatctacaatggc
gccttgccatgtcagtgtgaccctcaaggctcactgagttctgaatgcagtcctcacggt
ggccagtgccggtgcaaacctggagtggttggacgccgttgtgatgtctgtgctactggc
tactatggctttggccctgcaggctgtcaagcctgccagtgtagtcctgatggagcactc
agtgccctctgtgaagggactagtggacagtgcccctgccgacctggtgcctttggtctt
cgctgtgaccactgtcaacgtggccagtggggattccctaattgccggccgtgtgtctgc
aatgggcgtgcggatgagtgtgatacccacacaggcgcttgcctgggctgccgtgattac
acggggggcgagcactgtgaaaggtgcattgctggttttcatggggacccacggctgcca
tatgggggccagtgccggccttgtccctgccctgaaggccctgggagccagcgacacttt
gctacttcttgccaccgggatggatattcccagcaaattgtgtgccagtgtcgagaaggc
tacacagggcttcggtgtgaagcttgtgcccccgggcactttggggacccatcaaagcca
ggtggcaggtgccaactgtgtgagtgcagtggaaacattgatcccatggaccctgatgcc
tgtgatccccacacggggcaatgcttgcgttgtttacacaacacagaggggccccactgt
ggctattgcaagcctggcttccatgggcaagctgcccgacagagctgtcaccgctgtacc
tgcaaccttctgggcacagatcccaggcggtgcccatctaccgacctgtgccattgtgac
ccaagcactgggcagtgcccatgccttccccatgtccaaggcctcaactgtgaccattgt
gcccccaacttttggaacttcaccagtggccgtggctgccagccttgtgcttgtcaccca
agccgggccagaggccctacctgcaatgagttcacagggcagtgtcactgtcatgctggc
tttggtgggaggacttgttctgagtgccaagagctctactggggagaccctggtctgcag
tgccgtgcctgtgactgtgatcctagaggaatagacaaacctcagtgtcatcgttccaca
ggccactgtagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgctcgtggc
ttctcaggggtttttcctgcttgtcacccctgccacgcttgctttggagactgggatcgt
gtggtacaggacctggctgctcggacgcggcgcctggagcagtgggctcaggagttgcag
caaacaggagtgctgggtgcctttgagagcagctttttgaacatgcaggggaagctaggc
atggtgcaggccattatgagtgcccgcaatgcctcagccgcctctacggcgaagcttgta
gaggccacagagggactacgtcatgaaatcgggaagaccaccgagcgcctgactcagtta
gaagcagagctaacagctgtgcaggatgagaacttcaatgccaaccatgcactcagtggt
ctggagagagacgggcttgcgcttaatctcaccctgaggcagctggatcagcatctggag
atcctcaaacattcaaatttcttaggtgcctatgacagcatccgacatgcccacagccag
tccacagaggcagagcgccgtgccaacgcctccacctttgcagtacccagccctgtgagc
aactcagcagatacccggcgtcggacggaagtgctaatgggtgcccaaaaagaaaacttc
aaccgccaacatttggccaaccagcaggcactgggacggctctctgcacatgcccacacc
ctgagcctgacgggcataaatgagttggtgtgtggggcaccaggggacgcaccctgtgcc
accagcccttgtgggggtgccggatgtcgggatgaagatgggcagccccgttgtggtggc
ctcggttgcagtggggcagcagccacggcagatctagcgctgggccgggctcggcacacg
caggcagagctgcagcgggcactggtagaaggtggcggcatcctcagccgggtgtctgag
actcgtcggcaggcagaagaggcacagcagcgagcacaggcagccctggacaaggctaat
gcttccaggggccaggtggaacaggccaatcaggagcttcgagaacttatccagaatgtg
aaagacttcctcagccaggagggagccgatcctgacagtattgaaatggtagcgactcgg
gtgctagacatctccatcccggcctcacccgagcagatccagcgcctagccagtgagatt
gcagaacgcgtccgaagcctggccgacgtggacacaatcctggcccataccatgggcgac
gtgcgtcgggctgaacagctactgcaagatgcgcaccgggcacggagccgggccgagggt
gagagacagaaggcagagacagtccaagcggcactggaggaggctcagagggcacaagga
gctgctcagggtgccatctggggagcagtggttgacacacaaaacacagagcagaccctg
cagcgggtccaggagaggatggcaggtgcagagaagtctctgaactctgccggtgagcgg
gctcggcaattagacgccctcctggaggccctgaaactgaaacgggcaggaaatagcctg
gcagcatctacagcggaagaaacagcaggcagtgcccagagccgtgccagggaggctgag
aaacaactacgggaacaagtaggtgaccaataccaaacagtgagggcgttggcagagcgg
aaggctgaaggtgttctggctgcacaagccagggcagaacaactgcgggatgaggctcgg
gacctgttgcaggccgctcaggataagctgcagcggctacaggagctggagggcacatat
gaggagaacgagcgtgcactggagggcaaagcggcccagctggatgggctggaagccagg
atgcgcagtgtgctccaggccatcaacttgcaggtccagatctacaacacctgccagtga

KEGG   Mus musculus (mouse): 16780
Entry
16780             CDS       T01002                                 

Gene name
Lamb3
Definition
(RefSeq) laminin, beta 3
  KO
K06244  laminin, beta 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16780 (Lamb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16780 (Lamb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16780 (Lamb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16780 (Lamb3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16780 (Lamb3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16780 (Lamb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16780 (Lamb3)
   05145 Toxoplasmosis
    16780 (Lamb3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II F5_F8_type_C BNR_6
Other DBs
NCBI-GeneID: 16780
NCBI-ProteinID: NP_001264857
MGI: 99915
Ensembl: ENSMUSG00000026639
Vega: OTTMUSG00000025453
UniProt: Q61087
Position
1 H6; 1 97.71 cM
AA seq 1168 aa
MTAFFLLWLALPGFLCAQQACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQYG
QWQMKCCKCDSRLPRNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIM
MDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRP
NGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYFA
VSQLRLQGSCFCHGHADRCAPNPGGSTTAVQVNNVCVCQHNTAGPNCDRCAPFYNNRPWR
PAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYF
RNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFA
NPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCAC
DPRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDQTYGHVATGCRACDCDFRGTEG
PGCDKASGRCLCRPGFTGPRCDQCQRGHCDRYPVCVACHSCFQAYDTDLQEQARRLHSLR
NATEGLWTGTGLEDHGLASRLLDAKSKIEQIRQILEGTSVTEQDVAQVANGILSIRRTLQ
GLPLDLPLEEEMESFSGDLGNLDRSFSRLLLMYRSKKEQFEKLSSEDPSGAFRMLTMAYE
QSSRAAQQVSDSSSLLSQLRDSRREAEGLERQAGGGGTGGAQLMALRLEMASLPDLTPTI
NKLCGRSRQTACTPGDCPGELCPQDNGTACGSHCRGALPRAKGAFHMAGRVAEQLRNFNT
QLQQTRQMIRAAEEAASRVQADAQRLETQVSTSRLLMEEDVQRTRLLIQQVRGFLTDPDT
DAATIQQVSEAVLALWLPTDSATVLRKMKEIQAIAARLPNVDSVLSQTKQDIARARRLQA
EAEQARSRAHAVEGQVDDVVGNLRQGTVALQEAQDTMQGTGRSLRLIQERVGEVQQVLVP
AERLVKGMKEQMSGFWARMKELRRQAQEEQAQAMQARQLAEGASQQAMNAQEGFKRLKQK
YTELKDRLGQSPVLGEQGNRILSIKMEAEELFGETMEMMDKMKDMESELLRGSQAIMLRS
ADLSGLEKRVEQIRSYINGRVLYYATCK
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgacagcatttttcctcctgtggcttgccttgcctggcttcctgtgtgcccagcaagcc
tgctcccgaggggcctgttatccacctgtgggggacttgctcattggaaggactcagctt
cttcgagcctcatctacctgtggattgaccaaacctgagacctattgcacccaatatgga
cagtggcagatgaaatgctgcaagtgtgactccaggctgcctcgaaattacaacagtcac
cgagtggagaatgtcgcatcgtcttcaggccccatgcgctggtggcagtcacagaatgat
gtgagccctgtctctctgcagctggacctagacaagaggatgcagcttcaggacatcatg
atggattttaagggtctcacaccagctggcatgttgattgagcgctcttctgactttggc
aagacatggagggtgtaccagtacctggcgacagactgtgccagcacctttccccaggtc
caccagggccagcccaagaactggcaggacgtccggtgccggcccttgtcccagaggcct
aatgggcatctgactgggggaaaggtccaacttaaccttatggatttagcatcagctatc
cctgcatctcaaagtaaaaagattcaagaacttggggacatcacaaacttgagagtcaac
ttcaccaagctggcccctgtgccccagaggggctcctatccacccagcgcctactttgca
gtgtcacagctacgtctacaggggagttgcttctgtcacggacatgccgaccgctgtgcc
cctaatcctggaggttctaccactgctgtgcaggtcaacaatgtctgtgtctgccagcat
aacacagctggccccaattgtgaccgctgtgcccctttctacaacaaccgtccatggaga
cctgcagagggccaggacacccacgagtgccaaaggtgtgactgcaatgggcactcagag
acctgccacttcgacccagctgtgtttgctgccagccaggggacaaatggaggtgtgtgt
gacaactgccgggaccacaccgagggcaagaactgcgagcgctgtcagctacactatttc
cggaatagacgacccagcgctcccattcatgagacttgtattccctgtgagtgtgatcca
gatggagcagtccagggagctccctgtgaccgactgacgggccagtgtgtgtgcaaagag
tacgtgcaaggagagcgctgcgacctttgcaagcctggcttcaccgggctcaccttcgcc
aacccgaagggctgccatgcctgtgactgcagtatcttaggtgcccggaaagatatgcct
tgtgaggaggaaaccggacgctgcttgtgtctgcccaatgtagtgggccccaaatgtgac
cagtgtgccccttcccactggaagctggccagcggcctgggctgcgagccctgtgcctgt
gaccctcgcaactccctaagctcccagtgcaaccagtttacaggacagtgtccttgtcgg
gaagggtttggcggcctcacgtgtagttctgcagccatccgccagtgtcctgaccagacc
tatggacacgtggccacagggtgccgagcttgtgactgtgacttcagaggaacagagggt
cctggctgtgacaaagcctcaggccgttgcctctgccgccctggctttaccgggccccgc
tgtgaccaatgccaacgaggtcactgtgaccgctacccagtatgtgtggcctgccactcc
tgcttccaggcctatgacacagacctccaggagcaagctcgacgccttcacagtctccgt
aatgccaccgaaggcctgtggacagggacaggtctggaagaccatggcctggcttctcgg
ttgctagatgccaagagcaagattgagcagatcagacagattctggaaggcacttctgtc
acagagcaggatgtggctcaggtggccaatggcatcttgtctatcaggagaactcttcag
ggcctgccgctggacctgcccttagaggaggagatggaatccttctctggagacctgggg
aatctagacagaagcttcagtcggctcctccttatgtaccgaagcaagaaggagcaattt
gagaagctaagcagtgaagacccttcaggagccttccgcatgctgaccatggcttatgag
cagtcctcccgggctgcacagcaagtgtctgacagttctagcctgctgagccagttgagg
gacagtcgcagggaagcagagggcctggagagacaggctggaggaggaggcaccggagga
gctcagctcatggccctgcgcctagaaatggcttcgctgcctgacttgacacccaccatc
aacaagctttgtggcaggtctaggcagacagcctgtactccaggagattgccctggagag
ctgtgtcctcaggacaatggtacagcttgtggctctcactgcaggggagccctgcccaga
gccaaaggggccttccacatggcagggcgggtagctgagcagctacgaaacttcaacacc
cagctccagcagaccaggcaaatgatcagggcagccgaggaagcagcatcaagggtccaa
gccgatgcccagcgccttgagacccaggtgagtaccagccgcttgctgatggaggaagat
gtccagcgcacacggcttctcatccaacaggtccggggctttctcacagatcctgacaca
gatgcagccaccatccaacaggtcagcgaggcagtgctggctctctggctgcccacagac
tcagccacagtgctgcgcaagatgaaagagatccaggccattgcggccaggctccctaat
gtggactcagtgctatcccagaccaaacaagacatcgcacgggcccgcaggctccaggct
gaggctgagcaggccagaagccgagcccacgctgtggaagggcaggtagatgatgtggtc
gggaaccttcggcagggcaccgtggctctgcaggaagctcaggacacaatgcagggtact
ggccgctctcttcggctcatccaggaaagggttggtgaggttcagcaggtccttgtacca
gctgaaaggctggtgaaaggcatgaaggaacagatgagtggattctgggcacggatgaag
gagcttcgccgtcaggcccaggaggagcaggcccaggcaatgcaggcccggcagcttgca
gagggtgccagccagcaggcaatgaatgcccaggagggctttaagagacttaagcaaaag
tatacagagttgaaggaccggctgggtcagagtcctgtgctgggcgagcaaggcaatcga
atcctgagcatcaagatggaggcagaggagctctttggggagaccatggaaatgatggac
aaaatgaaagacatggagtcagagctgcttcgagggagtcaggctatcatgctgcgctct
gcagacctgtcggggctggagaagcgtgtggagcagatccgcagttacatcaatgggcga
gtgctctactatgccacctgcaagtga

KEGG   Mus musculus (mouse): 16782
Entry
16782             CDS       T01002                                 

Gene name
Lamc2, AA589349
Definition
(RefSeq) laminin, gamma 2
  KO
K06246  laminin, gamma 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16782 (Lamc2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16782 (Lamc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16782 (Lamc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16782 (Lamc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16782 (Lamc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16782 (Lamc2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16782 (Lamc2)
   05145 Toxoplasmosis
    16782 (Lamc2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 16782
NCBI-ProteinID: NP_032511
MGI: 99913
Ensembl: ENSMUSG00000026479
Vega: OTTMUSG00000049711
UniProt: G5E874
Position
1 G3; 1 65.26 cM
AA seq 1193 aa
MPALWLSCCLGVALLLPAAQATSRREVCDCNGKSRQCVFDQELHRQTGSGFRCLNCNDNT
AGVHCERCREGFYRHRDRDRCLPCNCHSKGSLSAGCDNSGQCRCKPGVTGQRCDRCQPGF
HMLTDAGCTRDQGQLDSKCDCDPAGISGPCDSGRCVCKPAVTGERCDRCRPGYYHLDRAN
PEGCTQCFCYGHSASCHASADFSVHKITSTFSQDVDGWKAVQRNGAPAKLHWSQRHRDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRQPSAYDVILEGAGLQIRAPL
MAPGKTLPCGITKTYTFRLNEHPSSHWSPQLSYFEYRRLLRNLTALLIRATYGEYSTGYI
DNVTLVSARPVSGAPAPWVERCVCPAGYKGQFCQECASGYKRDSARLGPFGACVPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGFFGDPFGERGPVRPCQRCQCNNNVDPNASGNCDQLTGRCLK
CIYNTAGVYCDQCKAGYFGDPLAPNPADKCRACNCSPMGSEPGECRGDGSCVCKPGFGGL
NCDHAALTSCPACYNQVKIQMDQFTQQLQSLEALVSKAQGGGGGGTVPSGELEGRMQQAE
QALRDILREAQISEGAMRALGFRLAKARSQENDYKTRLDDLKMTAERIRALGSQHQNRVQ
DTSRLISQMRLSLAGSEASLQNTNIHSSEHYVGPNGFKSLAQEATRLADSHAESANAMKQ
LARETEDYSKQALSLARKALSGGGGSGVLDSSVVQGLMGKLEKTKSLSQQLSREGTQADI
EADRSYQHSLRLLDSASQLQGVSDLSFQVEAKRIRQKADSLSNLVTRQTDAFTRVRNNLG
NWEKETRQLLQTGKDRRQTSDQLLSRANLAKNRAQEALSMGNATFYEVENILKNLREFDL
QVEDRKAEAEEAMKRLSSISQKVADASDKTQQAETALGSATADTQRAKNAAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLATLKSEMREMEGELARKELEFDTDKDTVQLVITE
AQQADARATSAGVTIQDTLNTLDGILHLIDQPGSVDEEGMMLLEQGLFQAKTQINSRLRP
LMSDLEERVRRQRNHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctcagctgctgccttggtgtcgcgctcctgctgcccgcagcccag
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcaatgtgtctttgat
caggagctccatcgacagacaggcagcgggttccgttgcctcaactgcaatgacaataca
gcgggggttcactgcgagcggtgcagggaggggttttaccgacatcgagacagagaccgc
tgcctaccctgcaactgccactcaaagggttccctcagtgctggatgtgacaactctgga
caatgcaggtgtaagccaggtgtgacaggacaaagatgtgaccgatgtcagccaggcttc
catatgctcaccgatgctggatgcacccgagaccaggggcaactagattccaagtgtgac
tgtgacccagctggcatctctggaccctgtgattctggccgatgtgtctgcaaaccagcc
gtcactggagagcgctgtgataggtgccgaccaggctactatcatctggaccgggcaaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccacgcctctgcc
gacttcagtgtccacaaaatcacttcaactttcagtcaggatgtggatggttggaaggcg
gttcagagaaacggggcacctgcaaaactccactggtcacagcgccatcgggacgtgttt
agttctgcccgaagatcagaccccgtctatttcgtggcccctgccaaattcctcggtaac
cagcaagtgagttacgggcagagcctgtcttttgactaccgcgtggacagaggaggtaga
cagccgtctgcctacgatgtgatcctggaaggtgctggtctacagatcagagctcctctg
atggctccaggcaagacacttccctgtgggatcacaaagacttacacattcagactgaat
gaacatccaagcagtcactggagtccccagctgagttatttcgaatatcgaaggttactg
cggaacctcacagccctcctgatccgagctacgtacggagaatatagtacagggtacatt
gataacgtgaccctggtttcagcccgccctgtctctggagccccagccccttgggttgaa
cgttgtgtatgccctgctgggtacaagggacaattctgccaggaatgtgcttctggttac
aaaagagattcggcaagattggggccttttggcgcctgtgttccctgtaactgccaaggg
ggaggggcctgtgatccagacacgggagattgctactcgggggacgagaatcctgacatt
gagtgtgctgactgtcccatcggtttctacaatgacccacatgacccccgcagctgcaag
ccatgtccctgtcacaatgggttcagctgttcagtgatgcctgagacagaggaggtggtg
tgtaacaactgtccccctggggtcacaggtgcccgctgtgagctctgtgctgatggcttc
tttggggatccctttggggaacgtggcccagtgaggccttgtcaacgctgccaatgcaac
aacaacgtggaccccaatgcctctgggaactgtgaccagttgacaggcagatgcttgaaa
tgtatctacaacacggccggtgtctactgtgaccagtgcaaagcaggttactttggagac
ccattggctcccaacccagcagacaagtgtcgagcttgcaactgcagccccatgggctcg
gagcctggagagtgtcgaggtgatggcagctgtgtttgcaagccaggctttggcggcctc
aactgtgatcacgcagccctaaccagttgtcctgcttgctacaatcaagtgaagattcag
atggaccagtttacccagcagctccagagcctggaggccctggtttcaaaggctcagggt
ggtggtggtggtggtacagtccccagtggggagctggaaggcaggatgcagcaggctgag
caggcccttcgagacattctaagagaagctcagatttcagaaggggcaatgagagccctt
ggcttccggctggccaaggcaaggagccaagagaacgactacaagacccgcctggatgac
ctcaagatgactgcagaaaggatccgggccctgggcagtcagcatcagaacagagttcag
gatacgagcagactcatctctcagatgcgcctgagtctggcaggaagcgaagcttccctg
caaaacactaatatccattcttctgagcactacgtggggccgaatggatttaaaagtctg
gctcaggaggctacaagattggcagacagccacgctgagtcagctaacgcaatgaagcaa
ctagcaagggaaactgaggactactccaaacaagcactttcattggcccgcaaggctctg
agtggaggaggcggaagtggcgtcttggacagctccgtggtacaaggtcttatgggaaaa
ttagagaaaaccaagtccctgagccagcagctgtcaagggagggcacccaagccgacatt
gaagctgataggtcgtatcagcacagtctccgcctcctggattctgcctctcagcttcag
ggagtcagtgatctgtcctttcaggtggaagcaaagaggatcagacaaaaggctgattct
ctctcaaacctggtgaccagacaaacggatgcattcacgcgtgtgcgaaacaatctgggg
aactgggaaaaagaaacacggcagcttttacagactggaaaggataggagacagacttca
gatcagctgctttcccgtgccaaccttgctaaaaacagagcccaagaagcgctaagtatg
ggcaatgccactttttatgaagttgagaacatcctgaagaacctccgagagtttgatctg
caggttgaagacagaaaagcagaggctgaagaggccatgaagagactctcctctattagc
cagaaggttgcagatgccagtgacaagacccagcaagcagaaacggccctggggagcgcc
actgccgacacccaacgggcaaagaacgcagctagggaggccctggagatcagcagcgag
atagagcaggagatagggagtctgaacttggaagctaatgtgacagcagatggggccttg
gccatggagaagggactggccactctgaagagcgagatgagagagatggagggggagctg
gccagaaaggagctggagtttgacacggataaggacacggtgcagctggtgattactgaa
gcccagcaagctgatgccagagccacgagtgccggagttaccatccaagacacactcaac
acattggacggcatcctacacctcatagaccagcctggcagtgtggatgaagaagggatg
atgctattagaacaagggcttttccaagccaagacccagatcaacagtcgacttcggccc
ttgatgtctgacctggaggagagggtgcgtcggcagaggaaccacctccatctgctggag
accagcatagatggaattctagctgatgtgaagaacctggagaacattcgagacaacctg
cccccaggctgctacaatacccaagctcttgagcaacagtga

KEGG   Mus musculus (mouse): 226519
Entry
226519            CDS       T01002                                 

Gene name
Lamc1, Lam, Lamb2
Definition
(RefSeq) laminin, gamma 1
  KO
K05635  laminin, gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05020  Prion disease
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    226519 (Lamc1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    226519 (Lamc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    226519 (Lamc1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    226519 (Lamc1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    226519 (Lamc1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    226519 (Lamc1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    226519 (Lamc1)
   05145 Toxoplasmosis
    226519 (Lamc1)
  09164 Neurodegenerative disease
   05020 Prion disease
    226519 (Lamc1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 226519
NCBI-ProteinID: NP_034813
MGI: 99914
Ensembl: ENSMUSG00000026478
Vega: OTTMUSG00000030992
UniProt: F8VQJ3
Structure
PDB: 
1KLO 5MC9 1NPE 4AQT 1TLE

Position
1 G3; 1 65.3 cM
AA seq 1607 aa
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPVKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKKKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt   +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgctggccctgcagccccgggggcggctgtggccgctg
ttggctgtgctggcggctgtggcgggctgtgtccgggcggccatggacgagtgcgcggat
gagggcgggcggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccgcccgaggagtactgcgtgcagactggggtg
accggagtcactaagtcctgtcacctgtgcgacgccggccagcagcacctgcaacacggg
gcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgcctcaagttccacaccagccgtccagagagcttcgccatc
tataagcgcactcgggaagacgggccctggattccttatcagtactacagtgggtcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggaccggaggggacgagcagcag
gccttgtgtactgatgaattcagtgacatttcccccctcaccggtggcaacgtggccttt
tcaaccctggaaggacggccgagtgcctacaactttgacaacagccctgtgctccaggaa
tgggtaactgccactgacatcagagtgacgctcaatcgcctgaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcttactattacgcaatctcagactttgctgtg
ggcggcaggtgtaaatgtaacggacatgccagcgagtgtgtaaagaacgagtttgacaaa
ctcatgtgcaactgcaaacataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaatgaccggccgtggaggagggcgactgctgagagcgccagcgagtgccttccttgt
gactgcaatggccgatcccaagagtgctactttgatcctgaactataccgttccactgga
catggtggccactgtaccaactgccgggataacacagatggtgccaagtgcgagaggtgc
cgggagaatttcttccgcctggggaacactgaagcctgctctccgtgccactgcagccct
gttggttctctcagcacacagtgtgacagttacggcagatgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgttgtcagcctgggttccattccctcactgaggcaggatgc
aggccatgctcctgcgatccttcgggcagcacagacgagtgtaatgttgaaacaggaaga
tgcgtttgcaaagacaatgttgaaggcttcaactgtgagagatgcaaacctggatttttt
aatctggagtcatctaatcctaagggctgcacaccctgcttctgctttggccattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccacctttcagattgat
gaggatgggtggcgcgtggagcagagagatggctcggaggcgtctctggagtggtcctca
gacaggcaagatattgccgtaatctcagacagttactttcctagatacttcatcgcccct
gtgaagttcctgggcaaccaggtcctgagttatgggcagaatctttccttctccttccga
gtggacagacgagacactcgcctctccgcagaggaccttgtgctcgaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcctaccccagcgagaccactgtgaag
tacatcttcaggctccatgaagcaacggattacccttggaggcccgctctctccccgttt
gaatttcagaagctcctgaacaacttgacctctatcaagatccgtggtacatacagcgag
aggagcgctgggtacttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cctgcaacgtgggtggagtcctgcacctgtccagtgggatacgggggacagttctgtgag
acgtgcctcccagggtacagaagagaaactccaagccttggaccttatagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgacccggagacaggtgtctgtgactgc
agagacaatacagccggcccccactgtgagaaatgtagcgatgggtactatggggactca
accctgggcacctcctctgactgccagccttgtccctgccccggtggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacgcactgtccgactggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcaatgggcctgtg
agactgtgccgcccgtgccagtgtaacgacaacatagaccccaacgcggttggcaactgc
aaccgcctgacgggcgagtgcctgaagtgcatctataacacggctggtttctactgcgac
cggtgcaaggaagggtttttcggaaatcccctggctcccaatccagccgacaaatgcaaa
gcctgcgcctgcaatccctacgggacagtgcagcaacagagcagctgtaacccggtgacc
ggacagtgccagtgtctgcctcatgtgtctggccgcgactgcggtacttgtgaccctggc
tactacaacctgcagagcgggcaaggctgcgagaggtgtgactgccatgctttgggttcc
accaatgggcagtgtgacatccgcaccgggcagtgtgagtgccagcctggcatcaccggc
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcaccatgaaggatccctttcactccagtgtaaagaggacggccgttgtgaa
tgcagggaaggctttgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcctggcctggctgccaggagtgtccggcttgttaccgactggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttagagagcctcatcgccaaccttggcactggg
gatgacatggtgacagatcaagcctttgaggacagacttaaggaagcagaaagggaggtg
acagaccttctccgtgaggctcaggaagtcaaagatgtagatcaaaatctgatggatcgc
cttcagagagtaaatagcagcctgcatagccaaattagccgactgcagaatatccggaat
actatcgaagagaccgggatcttggctgagcgagcacggtcccgagtggagagtacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggagccaaacaacatgaccctcttggcagaagaa
gcccgaaagcttgcagagcgtcataaacaggaagccgatgacattgtacgagtggcaaag
acagccaacgagacttcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcgctggagattgaagaacttaaccggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgcccgagtccatgaggaagccaagcgtgcaggtgac
aaagccgtagagatctatgccagtgtggcccagctgacccctgtggactctgaggccctg
gagaatgaagcaaataaaatcaagaaagaagctgcagacctggaccgtctgattgaccag
aagctaaaggattacgaggacctcagggaagacatgagaggaaaggaacatgaagtgaag
aaccttctagagaaggggaaagctgaacagcagaccgccgaccaactcctagctcgagcc
gatgctgccaaggcccttgctgaagaagctgctaagaagggacgcagtaccttacaagaa
gccaatgacattctcaacaacctgaaagattttgatagacgcgtgaacgataacaagaca
gccgcggaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcccagctagcgctgggcaatgctgccgctgacgccacggaggcc
aagaacaaggcccatgaggcagagaggattgccagcgccgtgcagaagaatgccaccagt
accaaggcggacgcagaaagaaccttcggggaagttacagatctggataatgaggtgaat
ggtatgctgaggcagctggaggaggcagagaatgagctgaagaagaagcaagatgatgcc
gaccaggacatgatgatggcagggatggcttcgcaggctgctcaggaggctgagctcaat
gccagaaaggccaaaaactctgtcagcagcctcctcagccagctgaacaacctcttggat
cagctaggacagctggacacagtggacctgaacaagctcaatgagatcgaaggctccctg
aacaaagccaaagacgaaatgaaggccagcgacctggacaggaaggtgtctgacctggag
agcgaggctcggaagcaggaggcagccatcatggactataaccgggacatagcagagatc
attaaggatattcacaacctggaggacatcaagaagaccctaccaaccggctgcttcaac
accccgtccatcgagaagccctag

KEGG   Mus musculus (mouse): 23928
Entry
23928             CDS       T01002                                 

Gene name
Lamc3, 1110064A23, 1110064A23Rik, AI562206, AW240805
Definition
(RefSeq) laminin gamma 3
  KO
K06247  laminin, gamma 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    23928 (Lamc3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    23928 (Lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23928 (Lamc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23928 (Lamc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    23928 (Lamc3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23928 (Lamc3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    23928 (Lamc3)
   05145 Toxoplasmosis
    23928 (Lamc3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B XhlA
Other DBs
NCBI-GeneID: 23928
NCBI-ProteinID: NP_035966
MGI: 1344394
Ensembl: ENSMUSG00000026840
Vega: OTTMUSG00000012245
UniProt: Q9R0B6
Position
2; 2 B
AA seq 1581 aa
MAVSRVLSLLATVASMALVIQETHFAAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPLQWSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSPPPIQLRLEGAGLALSLRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLASLQKGSSTPTNWSHLASEAQILARSHRDTATKIEATSERALLASNASYE
LLKLMEGRVASEAQQELEDRYQEVQAAQTALGIAVAEALPKAEKALATVKQVIGDAAPHL
GLLVTPEAMNFQARGLSWKVKALEQKLEQKEPEVGQSVGALQVEAGRALEKMEPFMQLRN
KTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKKAGSIRTRLLED
TKRKTKQAERMLGNAASLSSSTKKKSKEAELMSKDNAKLSRALLREGKQGYRHASRLASQ
TQATLRRASRLLLTSEAHKQELEEAKQVTSGLSTVERQIRESRISLEKDTKVLSELLVKL
GSLGVHQAPAQTLNETQRALESLRLQLDSHGALHHKLRQLEEESARQELQIQSFEDDLAE
IRADKHNLETILSSLPENCAS
NT seq 4746 nt   +upstreamnt  +downstreamnt
atggctgtatccagggtcctgtccctcctggcaacggtggcatcgatggcgctggtgatt
caggagacacacttcgcggcaggcgcggacatgggctcttgctacgacggtgtgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcc
cacacgtgcggacggcccccggaggacttctgtccacacgtgggggcaccaggggctggg
ctacagtgccagcgctgcgacgatgctgaccccggacgacgccacgacgcctcctacctc
acagacttccacagccccgatgacagcacctggtggcagagcccatccatggccttcggg
gtgcagtaccccacctctgttaacctgaccttgagcttagggaaggcctatgagattacc
tatgtgaggctgaagttccacaccagtcgccctgagagttttgccatctacaagcgcacg
tacgccagtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccgtcctgagggccactacctgcgaccgggcgaggatgagagggtggccttctgcacc
tctgagttcagtgacatctcccccttgaacgggggcaacgtggccttctccaccctggaa
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggtcaccagc
actgacatcctgatctctctagatcggctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgaatgcgaacccaatgcggctggtcagctggcttgccgc
tgtcagcacaacaccacaggagtggactgcgagcgttgtctgcccttcttccaggaccgt
ccgtgggcccgaggcaccgccgaggatgccaacgagtgtctgccctgcaactgcagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacaggccatggtgggcac
tgtcagcggtgccgtgaccacacaactgggccacactgtgagcgctgtgagaagaactac
tacagatggtccccgaagacaccatgccaaccctgtgactgccacccagcaggctctctg
agtctccagtgtgacaactcaggcgtctgtccctgcaagcccacagtgacaggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtgcc
tgcaatgtcgccggcagcttgggcacctgtgacccccgcagtgggaactgtccctgcaaa
gagaatgtagaaggcagcctgtgtgacagatgccgccctgggacatttaacctgcagccc
cacaatccagtgggctgcagcagctgcttctgttatggccactccaaggtgtgttctcct
gctgccgggttccaggaacaccacatccgctcagacttccgccatggagctggtggctgg
cagatcagaagcatgggagtgtccaagcgtcctctgcaatggagccagagtgggctcctc
ctgggcctgcgaggaggggaggaactctcagccccaaagaagttcctgggagaccagaga
ctcagctatggacagccagtcatactgaccctccaagtaccccctggaggctccccacct
cctattcagctgagactggagggagcaggcttggctctgtctctgaggccctccagtcta
cccagccctcaggacaccaggcagccaagacgagttcagctccagttcctcttgcaggag
acttctgaggaggcagagtccccactgcccaccttccacttccagcgcctgctttccaat
ctgactgctctgagcatctggaccagtggccaaggaccgggccattctggccaagtgctc
ttgtgtgaagttcagctcacatcggcctggccccagcgtgagcttgcccctccagcctct
tgggtggagacctgcttatgtccccagggatacacaggccagttctgtgaattctgtgct
ctgggatacaagagagaaatacctcatgggggtccctatgccaactgcattccctgcacc
tgcaaccagcatggcacctgtgaccccaacacagggatctgcctgtgtggccaccacacc
gagggtccatcctgtgagcggtgcatgccaggtttctacggtaacgccttctcaggccgt
gctgatgattgccagccctgtccgtgccctggccaatcagcctgtgcaaccatcccagag
agtggagatgtggtgtgcacacactgccctcctggtcagagaggacgacgatgcgagagc
tgcgaagatggcttttttggggatcctctagggctctctggagctccccagccctgccgc
cgatgccagtgcagcgggaacgtggatctcaatgctgtgggcaactgtgatcctcattct
ggccactgcttgcgctgtctgtacaacacgacaggggcccactgcgagcactgtcgggag
ggtttctacgggagtgccgtggccacaaggcccgtggacaaatgtgctccctgcagctgt
gacctgaggggctcagtcagtgagaagacctgcaaccctgtgactggccagtgtgtctgc
ctgccttatgtctccgggagggactgcagccgctgcagccctggcttctatgacctccag
tctgggaggggctgccagagctgcaaatgtcacccacttggatccttggagaataagtgc
caccccaagactggccagtgtccctgccgacctggtgtcactggccaagcctgtgacaga
tgccagctaggtttctttggcttctccatcaagggctgccgagactgtaggtgctcccca
ttgggtgctgcctcatctcagtgccatgagaacagcacctgtgtgtgccggcccggcttt
gtgggctataaatgcgaccgctgccaggacaatttcttcctcgcggatggcgacacaggc
tgccaagagtgtcccacttgctatgccctagtgaaggaagaggcagccaagctgaaggcc
aggttgatgctgatggaggggtggcttcaaaggtctgactgtggtagcccctggggacca
ctagacattctgcagggagaagcccctctgggggatgtctaccaaggtcaccacctactt
caagagacccgggggaccttcctgcagcagatggtgggcctggaggattctgtgaaggcc
acttgggagcagttgcaggtgctgagagggcatgtacactgtgcccaggctggagctcag
aagacctgcatccagctggcagagctggaggagacattgcagtcctcagaggaggaggtc
cttcgtgcagcctcagctctctcatttctggcaagtcttcagaaaggatccagcacaccc
accaattggagtcacctggcatcagaggcccagatccttgccagaagccacagggacacg
gccaccaagatcgaagctacctcggaaagggccctgctcgcctccaacgccagctatgag
ctcctgaagctgatggaaggcagagtggcctcggaagcccagcaggaactggaggacagg
taccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctgccc
aaagctgaaaaggcactggccacggtgaagcaagtcattggtgacgcagccccacatcta
ggcttgctggtcacccctgaagcaatgaacttccaagccaggggcctgagctggaaagtg
aaggccctggagcagaagctggagcagaaggagcccgaggtgggccagtctgtgggagcc
ctgcaggtggaggctggaagagccttggagaagatggagccctttatgcagctacgcaat
aagaccacagctgccttcacacgggcttcctcagctgtgcaagctgccaaggtgaccgtc
ataggagcagagaccctgctagctgacctagagggaatgaagctgaggtctcctctaccc
aaggagcaggcagcgctgaagaagaaagcaggcagcatcaggaccaggctcctggaggac
acaaagaggaagaccaagcaggcagagaggatgctgggaaatgctgcctctctctcctcc
agcaccaagaagaaaagcaaagaagcagaactgatgtctaaggacaatgccaagctctcc
agagctttgctgagggaaggcaagcagggctaccgtcatgccagccgactcgccagccag
acccaggccacactccgtcgggcctctcgcctgctgctgacctcagaagcacacaagcag
gagctggaggaagctaaacaggtgacctctgggctgagcactgtggagcgccagatccga
gagtctcggatctccttggagaaggacaccaaggtcctgtcagagctgcttgtgaagctg
gggtccctgggtgtccaccaagcccctgctcagaccctgaacgagacccagcgggcacta
gaaagcttgaggctgcagctggattcccacggagccctgcatcacaaactgaggcagctg
gaggaagagtctgctcgacaggagctgcagattcagagctttgaggacgaccttgctgag
atccgcgctgacaagcacaacttggagaccattctgagcagtctgccagagaactgtgcc
agctag

DBGET integrated database retrieval system