KEGG   Mus musculus (mouse): 16776Help
Entry
16776             CDS       T01002                                 

Gene name
Lama5, AA408760, AA408762, AI853660, [a]5, laminin-511, mKIAA0533
Definition
(RefSeq) laminin, alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16776 (Lama5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16776 (Lama5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16776 (Lama5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16776 (Lama5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16776 (Lama5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16776 (Lama5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16776 (Lama5)
   05145 Toxoplasmosis
    16776 (Lama5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 16776
NCBI-ProteinID: NP_001074640
MGI: 105382
Ensembl: ENSMUSG00000015647
Vega: OTTMUSG00000016271
UniProt: Q61001 Q3TZ05
Structure
PDB: 

Position
2 H4; 2 102.7 cM
AA seq 3718 aa AA seqDB search
MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGGDGFSLHPPYFNLAEG
ARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAH
PVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERS
TDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLV
NGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDIS
IGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANE
CQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFFRA
PDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYPLP
SFPHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFRGAHCELCAPGFH
GPSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQLCGCSPAGT
LPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGALDQQCGVGGLCHCRP
GYTGATCQECSPGFYGFPSCIPCHCSADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVPGA
YNFPYCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCT
RCSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRSCRCDVGG
ALGQGCEPKTGACRCRPNTQGPTCSEPAKDHYLPDLHHMRLELEEAATPEGHAVRFGFNP
LEFENFSWRGYAHMMAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQISVREEGKLS
SCTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLDYVVLLPS
TYYEAALLQHRVTEACTYRPSALHSTENCLVYAHLPLDGFPSAAGTEALCRHDNSLPRPC
PTEQLSPSHPPLATCFGSDVDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAP
QQGVLNLHPCPYSSLCRSPARDTQHHLAIFYLDSEASIRLTAEQAHFFLHSVTLVPVEEF
STEFVEPRVFCVSSHGTFNPSSAACLASRFPKPPQPIILKDCQVLPLPPDLPLTQSQELS
PGAPPEGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLLHGYQPVHPSFPV
EVLINGGRIWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWLDY
VLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSPFCRNAATSLSLFYNNGA
LPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELT
GQCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPN
VAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHCKENVQGSRCDQCRVGTF
SLDAANPKGCTRCFCFGATERCGNSNLARHEFVDMEGWVLLSSDRQVVPHEHRPEIELLH
ADLRSVADTFSELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDIFIPYESRPDVVLQG
NQMSIAFLELAYPPPGQVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALF
SQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLG
RCVPCQCHGHSDRCLPGSGICVGCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLA
VPSNNFADGCVLRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPN
MIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNALLPGNCTRCDCSPCGTETCDPQSG
RCLCKAGVTGQRCDRCLEGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQ
CLECAPGYWGLPEKGCRRCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPG
GHGIHCEVCDHCVVLLLDDLERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQSK
LRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQATGVQGQAGQLLDTTESTLGRAQKL
LESVRAVGRALNELASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVA
EAELAEAQRLMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREA
EELNSRNQERLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKEDLEHLA
ASLDGAWTPLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIILGINQDRFIQRA
VEASNAYSSILQAVQAAEDAAGQALRQASRTWEMVVQRGLAAGARQLLANSSALEETILG
HQGRLGLAQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAE
ALSTATHVQSQLQGMQKNVERWQSQLGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLS
RLENRGVHNASLALSANIGRVRKLIAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAA
YTALKFHIQSPVPAPEPGKNTGDHFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPT
TLSIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVF
YVGGYPSNFTPPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATG
DPWLTDGSYLDGSGFARISFEKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQEG
TLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQDNM
LEMADAYYLGGVPPEQLPLSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCT
ADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPYQVSL
REGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTTPMLQL
QPEEPSRLLLGGLPVSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQ
LIETSRATAQKVSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGISPSHRNR
LHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRA
GQWHRVSVRWGMQQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLPASSYSSKLP
VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLELPKAKMPY
VSLELEMRPLAAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFSTWVTYPKLCDG
RWHRVAVIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKSSTARPELPAYRG
CLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH
NT seq 11157 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgcggagggcagctctgcgcggggagcgcaccgggcgctcttggcccccgg
agccccgcgccacggccgctgctactgctgctggctggactggcgctggtaggcgaggcg
cgcactcccgggggcgatggcttcagcctgcacccgccctacttcaacctggcggagggc
gctcgcatcaccgcgtccgcgacctgcggcgaggaggccccgacgcgcagtgtctcacgc
cccaccgaggacctctactgcaagctggttgggggtccggtggctggcggagatcccaat
cagacaatccagggccagtactgtgacatctgtacagctgccaacagcaacaaggcacac
cctgtgagcaacgccatcgatggcacggagcgctggtggcagagcccacccctgtcccgt
ggcctggagtacaatgaggtcaacgtcacactggacctgggccaggtgttccatgtggcc
tatgtgctcatcaagtttgccaactcacctcggcctgacctctgggtgctggagcggtcc
acagacttcggtcacacttatcagccgtggcagttctttgcctcctccaagagggattgt
ttggagcggtttggacctcggactctagagcgcatcacgcaggacgacgacgtcatctgc
accacagaatactcgcgaatagtgcctttggagaatggcgagattgtggtgtccttggta
aatgggcgccctggggccttgaacttctcctactcaccgttacttcgagacttcaccaaa
gccaccaacatccgcttgcggtttctgcgaaccaacacgctactgggccacctcatgggc
aaggcgctgcgggaccccacagtcacccgcaggtattattacagcatcaaagacatcagc
attggtgggcgctgtgtctgtcatggccacgcagatgtctgtgacgccaaggacccattg
gatcctttcaggctgcagtgtgcctgccagcacaatacatgtggaggctcttgtgaccga
tgctgtccaggcttcaaccagcagccgtggaagcccgccaccacggacagcgccaatgag
tgccagtcctgcaattgccacggccatgcctacgactgttactacgaccctgaggtggat
cggcgcaatgccagccagaaccaggacaacgtgtaccagggtggaggtgtctgcctggat
tgccagcatcacactacgggtatcaactgtgagcgttgtctgcctggcttcttccgtgcc
cctgaccagcctctcgactcacctcatgtctgtcggccctgcgactgtgagtcagacttc
acggatgggacctgtgaagacttgacgggccgctgttactgcaggccgaacttcacagga
gagctatgtgctgcctgcgctgagggctacacggacttcccacactgctaccctctgcct
tcatttccccacaatgacacgagagaacaggtgcttcccgctggacaaatcgtgaactgt
gattgcaatgctgcagggacccagggcaatgcctgccggaaggacccaaggttgggacgg
tgtgtctgcaaacccaacttccggggtgcccactgtgagctctgtgctcctggattccac
gggcctagctgccacccatgccagtgttccagccctggggtagccaacagcctctgtgac
ccagagtctggccagtgcatgtgccgcaccggctttgagggggacaggtgtgaccactgt
gcccttggctatttccacttccctctctgtcagctgtgtggctgcagcccagcagggacc
ttgcctgaaggctgtgacgaggctggccgctgccagtgccgacctggctttgacggtcct
cactgtgaccgatgccttccaggataccatgggtatcccgactgtcacgcttgtgcctgt
gaccctcggggggccctggatcagcagtgtggagtgggcggtttgtgccactgccgtcct
ggctacacaggtgccacttgtcaggaatgtagccccggcttctacggcttccccagctgc
atcccctgccactgctctgccgatggctccttgcatacaacctgtgacccgacaaccggc
cagtgtaggtgtcgaccccgagtgacaggactacattgtgatatgtgtgtaccaggcgcc
tataacttcccctactgtgaagctggctcttgtcatcctgctggtctggccccagccaat
cctgcccttcctgagacacaggctccctgtatgtgccgggctcacgtggaagggccaagc
tgtgatcgctgtaaacctgggtactgggggctgagcgccagcaaccctgaaggctgcaca
cgctgcagctgtgacccacgaggcaccctgggtggagttactgagtgccagggcaatggg
cagtgcttctgcaaggctcacgtgtgtggcaagacctgtgcagcctgcaaggatggcttc
tttggcctggattatgctgactactttggctgccgtagctgtaggtgtgatgttggtggt
gccctgggtcaaggctgtgaaccaaagacaggtgcctgcaggtgccgccctaacacccaa
ggacccacctgtagcgagccagcgaaggaccactacttgccagacctgcaccacatgcgg
ctggaactagaggaggcggccactcccgagggccacgctgtacgctttggcttcaacccc
ctggagtttgagaactttagctggagaggctacgcacacatgatggctatccagcccagg
attgtggccaggctgaacgtgacctcccctgacctctttcggctggttttccgatatgtc
aaccgtggatcaaccagcgtgaatgggcagatctctgttcgtgaagagggcaagctttcc
agctgtaccaactgcacagagcagagccagccagtggctttcccacccagcactgagcct
gcctttgtcactgtgccccagaggggctttggggaaccctttgtgctgaaccccggcatc
tgggccttgctggtcgaggctgaaggtgtactcttggactacgtggtcctactgcccagc
acctactatgaggcagctctcctacagcatcgagtaacggaggcctgtacctaccgtccc
tcagccctgcactccacagagaactgtcttgtctatgctcacctacccctggatggcttc
ccttcagcagctggaactgaggccctgtgtcgccatgacaacagcctgccccggccctgc
cccacagagcagctcagcccctcacacccaccgctggcgacctgcttcggcagtgatgtg
gacatccagctcgagatggccgtgcctcagcctggccaatatgttctcgtggtggaatat
gtcggtgaggattcacaccaagagatgggagtggctgtgcacacccctcagagagccccc
cagcaaggggtgctcaacctccacccctgcccatacagctccctgtgccggagtccggct
cgggacacccagcatcatctagccatcttctacctggactctgaggctagcatccggctc
acagctgagcaagctcacttcttcctgcacagcgtcaccctggtacctgtggaggagttc
agtactgagtttgtggagccccgggtcttctgtgtgagcagtcatggaactttcaacccc
agcagtgctgcctgtctagcctcccgattcccgaagccaccgcagcccatcatccttaag
gactgccaggtcttgccgctgcctcccgacctgcctctgactcagtctcaggagctctca
ccaggtgcaccccccgagggaccacagcctcggccgccaactgcggtggatcctaatgca
gaacccaccttgctgcgccacccccagggcacggtggtcttcaccacccaggtgcccacc
ctgggccgctatgcctttctgctgcacggctaccagccggtccacccctccttccctgtg
gaggtactcattaatggtggccgcatctggcagggccacgccaacgccagcttttgtcct
catggttatggctgccgtaccctggtgttgtgtgagggtcagacgatgctggatgttaca
gacaacgagctcaccgtgactgtgcgtgtgccagaaggccggtggctctggctggactac
gtactcattgtccctgaggatgcttacagctccagttacctccaagaggagcctttggac
aaatcctatgacttcatcagccactgtgccacccagggctaccacattagccccagcagc
tcatctccattctgccggaatgccgccacctccttgtctctcttctacaacaacggggcc
ctcccttgtggctgccacgaggtgggtgccgtaagccccacgtgcgagcccttcgggggc
cagtgtccctgccggggccacgttattggccgtgactgttcccgctgtgccaccggctac
tggggtttccccaactgcaggccctgtgactgtggagcccgcctgtgtgacgagctcacg
ggccagtgtatctgtccaccacgcactgttccccctgactgcttggtctgccagccacag
agctttggttgccaccccttggtgggctgtgaggagtgtaactgctcagggcccggcgtc
caggagctgacggaccctacctgtgacatggacagcggccagtgcagatgcagacccaat
gtagctggacgtcgctgtgatacctgtgccccgggcttctatggctatcctagctgtcgc
ccctgtgactgccatgaggcaggcaccatggctagcgtgtgtgaccccctcacaggccaa
tgccattgcaaggagaacgtgcagggctcaagatgtgaccagtgtcgcgtggggaccttc
tccttggatgctgctaaccccaagggctgtacccgctgcttctgtttcggggccacagag
cgctgtgggaactctaacctcgcccgccatgagttcgtggacatggagggctgggtgctg
ttgagcagtgaccggcaggtggtaccccacgagcatcggcctgagatagagctgctgcac
gcagatctgcgctctgtggctgacactttctcagagctgtactggcaggctccgccctcc
tatctgggagacagggtgtcatcctacggtggaaccctccactatgagctgcactcagag
acccagcgaggtgatatcttcattccctacgagagccggccggacgtcgtgctgcagggc
aaccaaatgagcatcgccttcctggaactggcgtaccctccgcctggccaggttcaccga
ggacagctacagctggtagaggggaacttccggcacttggagactcacaaccccgtgtcc
cgagaagaactcatgatggtgctggccggcctggagcagctgcagatccgtgctctcttc
tcgcagacctcttccagtgtctccttgcgtagagtggtactggaggtggctagcgaggct
ggtagggggcctccagccagcaatgtggaactgtgtatgtgccctgccaactaccgtggg
gactcgtgccaggaatgtgcccctggctattaccgggacaccaagggtctcttcctaggc
cgatgtgtcccctgtcagtgccatggccattcagatcgctgccttcctggctctggcatt
tgtgtgggctgccagcacaacacagaaggggaccaatgtgagcgctgtaggcctggcttt
gtcagcagtgatcccagtaaccctgcatccccatgtgtgagctgcccttgccccttggca
gtgccctccaataattttgcagacggttgcgtcttaagaaatggccgaacccagtgcctc
tgcaggccaggctatgctggtgcctcctgcgagcggtgtgcacctggcttttttgggaac
cccctggtgctaggcagctcctgtcagccctgcgactgcagcggtaatggagaccccaac
atgatcttcagtgactgcgaccccctgacgggtgcctgtcgaggctgcctccgtcacacc
actgggccccactgtgaacgctgtgccccaggcttctatggcaatgctttgttgccaggc
aactgcacccggtgtgactgttccccatgtgggacagaaacctgtgatccccagagtgga
cgctgcctgtgcaaagcaggcgtgactggacaacgttgtgaccgctgtttggaaggatac
ttcggttttgagcaatgccagggctgccgcccttgtgcctgtggaccagctgccaagggc
tccgagtgccaccctcagagcggtcagtgtcactgccagccagggaccacaggaccccag
tgcctcgagtgcgcccctggctactggggcctcccagagaagggctgcaggcgctgccag
tgtccccgaggccactgtgacccacacacgggccactgcacctgtcccccggggctcagc
ggggaacgctgtgacacctgcagccagcagcaccaggtgcctgtaccgggcaagcctggg
ggccatggcatacactgtgaagtgtgtgaccactgtgtggttctccttctggatgacctc
gagcgggctggtgccctcctccccgctatccgtgagcagctgcagggtatcaatgccagc
tccgcggcctgggccaggctgcacaggctgaatgcctccattgctgacctgcagagtaaa
ctccggagcccaccgggaccccgctaccaggcagcacagcagctacagactctagagcag
cagagtataagccttcaacaggacacggagaggctgggcagtcaggccacaggggtccaa
ggtcaggcaggccagctactggacaccacagagtccacactgggccgggcacagaagttg
ttggagtctgtgcgagctgtgggccgtgccctgaatgagctggcatctcgcatgggccaa
ggatctccaggcgatgccttggtaccgtctggcgagcagctgcgctgggctctggctgaa
gtggagcggctgctctgggatatgcggacgcgtgacctgggggcccagggggcagtggca
gaggccgaactggccgaagcccagaggctgatggctcgtgtccaggagcagctgaccagc
ttctgggaggagaaccagtcattggccacacacattcgggaccagctggctcagtatgag
tctggcctcatggatcttcgtgaggccctgaaccaggccgttaataccacccgggaggct
gaggaactcaacagccgcaaccaggaacggctgaaggaagccctgcaatggaaacaggaa
ctgtcccaggacaatgccaccctgaaggccactcttcaagctgccagtctcatcttgggc
catgtttctgagcttctgcagggcatagaccaggctaaggaggacctagagcacctggcg
gccagcctggatggagcctggacacccttactgaagaggatgcaggccttttcccctgcc
agcagcaaggtggacttggtagaggctgctgaggcccacgctcagaagctgaaccagctg
gcaatcaacctgtctggcatcatccttggcatcaatcaggaccgcttcatccagagggct
gtggaagcctccaatgcctacagcagcatccttcaggccgttcaggctgccgaggatgcg
gcaggccaggcactgaggcaggccagccgcacatgggagatggtggtgcagcggggccta
gcagctggagcccggcagctgttagccaacagcagtgccctggaggagaccatccttgga
caccaggggaggctgggccttgctcagggccgtctgcaggctgcggggatccagcttcat
aatgtctgggccaggaagaaccagctagcagcccagatccaggaggcacaagccatgctg
gccatggacacgagcgagaccagtgagaagattgctcacgccaaggctgtggctgccgaa
gccctcagtacggccacccacgtgcagtctcagcttcagggtatgcagaagaatgtggag
aggtggcagagccagctgggaggcctgcaaggccaggacctgagccaggtggaacgggat
gcaagcagttcagtgtccaccctggagaagacattgccacagctgctggccaaactgagc
cgtctagagaaccgtggagttcacaatgccagcctggctttgtctgccaacattggtcgt
gtgcgcaagctcattgcccaagcccggagtgccgccagcaaggtcaaggtgtccatgaag
ttcaatgggcgttcaggggtacgactgcgtaccccacgagaccttgccgaccttgctgcg
tacactgccctcaagttccacatccagagcccagtgccagcgcccgaacctggcaagaac
acgggggaccactttgttctgtacatgggcagccgccaggccactggggactacatggga
gtgtctctgcgtaatcagaaggtgcactgggtgtacaggctaggaaaggctggccccaca
actctcagcatcgacgagaacatcggggagcagtttgcagccgtcagcatcgacaggacc
ctccagtttggccacatgtctgtcaccgtggagaaacagatggttcatgagatcaaggga
gacacggtggcccctgggagcgagggactactcaacctgcatcctgacgattttgtcttc
tacgtgggaggataccccagcaacttcacgccccctgaacccctccgattccctggctac
ctgggctgcattgagatggaaacactgaatgaggaggtggtcagcctctacaattttgag
cagaccttcatgctggacacggcagtagataaaccttgtgctcgctccaaggccaccggt
gacccatggctcacagatggctcctacctggatggcagtggctttgcccgcatcagcttt
gagaagcagttcagcaacacaaaacgctttgaccaggagctgcggcttgtgtcctacaat
gggatcatctttttcctcaagcaagagagccagttcttgtgcctggcagtgcaggaaggc
accctggtgctcttctatgacttcggctctggcctgaagaaggccgacccactgcagccc
ccacaagccttgacggcagccagcaaggcgatccaagtgtttctattggctggcaatcgc
aaacgtgtgttggtgcgtgtggagcgggccactgtgttcagcgtagaccaggataacatg
ctggagatggctgatgcctactacttgggaggtgtgccacctgaacagctgcccttgagc
ctacggcagctcttcccctccggaggctctgtccgtggctgcatcaagggtattaaggct
ctgggcaagtacgtggacctcaaacggttgaacaccacgggcatcagtttcggctgcacc
gctgacctgctagtgggacgcaccatgacttttcacggccacggcttcctgcccctggca
cttcctgatgtggcacccatcaccgaagtggtctattctggctttggctttcgtggcacc
caggacaacaacctgctgtattaccgtacctccccggatgggccgtaccaggtatccctg
agggagggccacgtgacactccgttttatgaaccaagaggtggaaactcaaagggtcttt
gctgatggtgctcctcactatgttgccttctatagcaatgtcacaggggtatggctgtat
gtggatgaccagctacaactagtaaagtctcatgagagaacaactcccatgctccaacta
cagcccgaggaaccctcacggcttctcctgggaggcctgcctgtgtctggtaccttccac
aacttcagtggctgcatcagcaatgtttttgtacagcgacttcggggaccacagcgtgtg
tttgacctacaccagaacatggggagtgtcaatgtaagcgtaggctgtacaccagcccaa
ctcatcgagacctcaagggccacggctcagaaggtttcccgccgtagtcgacaacccagc
caggaccttgcctgcacgacaccctggctccctgggactattcaggatgcataccagttt
gggggacccctgcccagttacctacagtttgtgggtatctctccgtcccacaggaatagg
ctccacctctccatgcttgtccgtccacatgcggcttcccagggcctcctgctctctaca
gcccccatgtcgggccgcagcccttcgttggtactctttctaaaccatggacactttgtc
gcacagactgagggccctgggccccggctccaggtccagagtcgccagcactcacgggct
ggccagtggcacagggtgtccgtccgctggggaatgcagcagatccagcttgtggtggac
ggcagccagacctggagccagaaggctctccaccatcgggtccccagggcagagcgacca
cagccctacaccctctctgtaggaggtcttcctgccagcagttacagttccaagctccct
gtgtctgtggggttcagcggctgtctgaagaaattacagctggataagcggccactgagg
accccaacgcaaatggtgggggtcacaccctgtgtctcaggccccctggaagatggcctg
ttcttcccaggcagtgagggagttgtcacattagagctccccaaggccaagatgccctat
gtgagcctggagctagagatgcggcccttggcagctgctggcctcatcttccacctgggc
caggccctggccactccctacatgcagctgaaggtgctgacagaacaggtcctgctgcag
gcaaatgatggggcaggggagttttccacgtgggtgacctaccccaagctttgtgatgga
cggtggcaccgagtggcagtgatcatgggcagggacacactccggctggaggtagacaca
cagagcaaccacaccacaggccgtttgccagagagcttggctggttctccagcacttctg
cacctcgggagcctgcccaagtcttcaactgctcggccagagctccctgcctaccgagga
tgcttgaggaagctgctgatcaatggggcccctgtcaacgtgactgcttctgtacaaatc
cagggggcagtggggatgcgcggatgcccctcaggaaccctagcactttccaagcaggga
aaggcactgacccagaggcaggccaagcccagtgtctccccgctactttggcattga

DBGET integrated database retrieval system