KEGG   Mus musculus (mouse): 16777
Entry
16777             CDS       T01002                                 

Gene name
Lamb1, C77966, C80098, C81607, D130003D08Rik, Lamb-1, Lamb1-1
Definition
(RefSeq) laminin B1
  KO
K05636  laminin, beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16777 (Lamb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16777 (Lamb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16777 (Lamb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16777 (Lamb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16777 (Lamb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16777 (Lamb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16777 (Lamb1)
   05145 Toxoplasmosis
    16777 (Lamb1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C HU-CCDC81_bac_2
Other DBs
NCBI-GeneID: 16777
NCBI-ProteinID: NP_032508
MGI: 96743
Ensembl: ENSMUSG00000002900
Vega: OTTMUSG00000035464
UniProt: E9QN70 Q3UHL7
Structure
PDB: 
5MC9 4AQS

Position
12 A2; 12 13.39 cM
AA seq 1786 aa
MGLLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGG
VCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVG
LIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCY
CKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQC
NEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFF
IDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGG
SGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQC
HCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDA
LRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTG
CGPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKF
LEKAKALKISGVIGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDV
TEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDS
ITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDE
LAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDL
RNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVI
LQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVK
QNADDVKKTLDGELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLL
EDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atggggctgctccaggtgttcgcctttggtgtcctagccctatggggcacccgagtgtgc
gctcaggaaccggagttcagctatggctgcgcagaaggcagctgctaccctgccactggc
gaccttctcatcggccgagcgcaaaagctctccgtgacttcgacatgtggactgcacaaa
ccagagccctactgtattgttagccacctgcaggaggacaagaaatgcttcatatgtgac
tcccgagacccttatcacgagaccctcaaccccgacagccatctcattgagaacgtggtc
accacatttgctccaaaccgccttaagatctggtggcaatcggaaaatggtgtggagaac
gtgaccatccaactggacctggaagcagaattccatttcactcatctcatcatgaccttc
aagacattccgcccagccgccatgctgatcgagcggtcttctgactttgggaaggcttgg
ggcgtgtacagatacttcgcctacgactgtgagagctcgttcccaggcatttcaactgga
cccatgaagaaagtggatgacatcatctgtgactctcgatattctgacattgagccctcg
acagaaggagaggtaatatttcgtgctttagatcctgctttcaaaattgaagacccttat
agtccaaggatacagaatctattaaaaatcaccaacttgagaatcaagtttgtgaaactg
cacaccttgggggataaccttttggactccagaatggaaatccgagagaagtactattac
gctgtttatgatatggtggttcgagggaactgcttctgctatggccacgccagtgaatgc
gcccctgtggatggagtcaatgaagaagtggaaggaatggttcacgggcactgcatgtgc
agacacaacaccaaaggcctgaactgtgagctgtgcatggatttctaccacgatttgccg
tggagacctgctgaaggccggaacagcaacgcctgcaaaaaatgtaactgcaatgaacat
tccagctcgtgtcactttgacatggcagtcttcctggctactggcaacgtcagcggggga
gtgtgtgataactgtcagcacaacaccatggggcgcaactgtgaacagtgcaaaccgttc
tacttccagcaccctgagagggacatccgggaccccaatctctgtgaaccatgtacctgt
gacccagctggttctgagaatggcgggatctgtgatgggtacactgatttttctgtgggt
ctcattgctggtcagtgtcggtgcaaattgcacgtggagggagagcgctgtgatgtttgt
aaagaaggcttctacgacttaagtgctgaagacccgtatggttgtaaatcatgtgcttgc
aatcctctgggaacaattcctggtgggaatccttgtgattctgagactggctactgctac
tgtaagcgcctggtgacaggacagcgctgtgaccagtgcctgccgcagcactggggttta
agcaatgatttggatgggtgtcgaccttgtgactgtgaccttggaggggcgctgaacaat
agctgctccgaggactccggccagtgctcctgcctgccccacatgattgggcggcagtgt
aacgaggtggagtccggttactacttcaccaccctggaccactacatctacgaagccgag
gaagccaatctggggcctggagtcattgtggtggaaaggcagtacattcaggaccgcatt
ccttcctggacaggacctgggttcgtccgggtgcctgaaggggcttatttggagtttttc
attgacaacataccgtattccatggagtatgaaatcctgattcgctatgagccacagctg
ccggaccactgggagaaagctgtcatcactgtacagcggccggggaagattccagccagc
agccgatgtggtaacaccgttcccgatgatgacaaccaggtggtgtccttgtcaccgggc
tcaagatacgttgtcctccctcgccccgtgtgctttgagaagggaatgaactacacggtg
aggttggagctgccccagtatacggcatcgggcagtgacgtggagagcccttacacgttc
atcgactcgcttgttctcatgccctactgtaaatcgctggacatcttcactgttggcggc
tcaggcgatggggaggtcaccaatagtgcctgggaaaccttccagcgctacaggtgtctg
gagaacagcaggagtgtggtaaaaacacccatgacagatgtctgcagaaacattatcttc
agcatttctgccttgattcaccagacgggccttgcttgtgaatgtgacccccagggatct
ctgagttctgtgtgtgaccccaatggtggccagtgccagtgccgtcctaatgtggttgga
agaacctgcaacaggtgtgccccgggcacctttggctttggccccaacggatgcaaacct
tgtgactgccatctgcaagggtctgccagtgccttctgcgatgcgatcactggccagtgc
cactgtttccagggcatctatgctcggcagtgtgaccgatgtctccctgggtattggggc
tttcccagctgccagccctgccagtgtaatggtcatgctctagactgtgacacagtgaca
ggggagtgtctgagctgtcaggactacaccacgggccacaactgcgaaaggtgcctggct
ggctactacggtgatcccatcattgggtcaggagaccactgtcgcccttgcccttgtcct
gatggtcctgacagtggacgacagtttgccaggagctgttatcaagaccccgtcactctc
cagcttgcgtgtgtttgtgatcctgggtacattggctccagatgtgatgactgtgcctct
ggattttttggcaatccctcagactttgggggttcatgtcaaccatgtcagtgccaccac
aacattgacactaccgatccagaagcctgtgacaaggagacgggacgatgcctcaagtgc
ctgtaccacacagaaggggaccattgccagctctgccagtatgggtactacggcgatgct
cttcggcaagactgtagaaagtgtgtctgcaattacctgggcacggtgaaggaacattgt
aatggctctgactgccactgtgacaaagccactggtcagtgctcgtgccttcccaatgtg
atcgggcagaactgtgaccggtgtgcgcccaacacctggcagctggctagcgggactggc
tgcgggccctgcaattgcaatgctgcgcattcctttgggccatcctgcaacgagttcaca
gggcagtgccagtgcatgccgggctttggaggccgaacctgcagcgagtgccaggagctc
ttctggggagaccctgatgtggaatgccgagcctgtgactgtgatcccaggggcattgag
acacctcagtgtgaccagtccacgggccagtgtgtctgtgtggagggtgtagagggtcct
cgctgcgacaagtgcaccagaggttactcgggggtctttcctgactgcacaccctgccac
cagtgctttgctctctgggatgctatcattggtgagctgaccaacaggacccacaaattc
ctggagaaagccaaggctctgaaaatcagtggtgtgattggtccctaccgagagaccgtg
gactctgtagagaagaaagtcaatgagataaaagacatcctggcccagagcccagcagcg
gaaccactgaaaaacattggcattctcttcgaggaggcagagaaactaaccaaagatgtc
acagaaaagatggcgcaggtagaagtgaaattaactgatacagcttcacagagtaacagc
acagctggagagctcggcgcactgcaggcagaagcagagagccttgacaagaccgtgaag
gagctggcagaacagctggagtttatcaaaaactccgatattcagggcgccttggatagc
atcaccaagtatttccagatgtctcttgaggcagagaagcgggtgaatgcctccaccaca
gaccccaacagcactgtggagcagtctgccctcacgcgagacagagtagaagatctgatg
ttggagcgagagtctccgttcaaggagcagcaggaggaacaggcacgcctcctggacgaa
ctggccggcaaactgcaaagtctcgacctgtcggctgttgcacagatgacctgtggaaca
cctccaggggctgactgttctgaaagtgaatgtggtggccccaactgcagaactgacgaa
ggagagaagaagtgtggggggcctggctgtggtggtctggtcactgtggcccacagtgct
tggcagaaagccatggattttgaccgtgatgtcctgagtgccctggctgaagtcgaacag
ctctccaagatggtctctgaagcaaaagtgagagcagatgaggcgaagcagaatgcgcag
gatgtcctgttaaaaacaaatgctaccaaagaaaaagtggacaagagcaacgaggacctg
cggaacctcatcaagcagatcagaaacttcctgactgaggatagtgctgatctagacagt
attgaagcagttgctaatgaagtactgaaaatggaaatgcctagcacgccacagcagtta
cagaacctaacagaagacattcgggagcgagttgaaaccctctctcaagtagaggttatt
ttgcagcagagtgcagctgacattgccagagctgagctgttgcttgaggaagctaagaga
gcaagcaaaagtgcaacagatgttaaagtcactgcagacatggtgaaggaagcattagaa
gaagcagaaaaggcccaggttgcagcagagaaggcgattaaacaagctgatgaggatatc
caaggaacccaaaacctgctaacatcgattgaatctgaaacggcagcttctgaggaaacc
ctgaccaacgcctcccagcgcatcagcaagcttgagaggaacgtggaagagcttaagcgt
aaagctgcccagaactctggggaggcagaatatatcgaaaaagtagtatattctgtaaaa
cagaatgcagacgatgttaagaagactctagatggcgaacttgatgaaaagtataagaag
gtagaaagtttaattgcccaaaaaactgaagagtcagcagatgccaggaggaaagctgag
ctgctacaaaatgaagcaaaaacactcttggctcaagctaacagcaagctccagctgttg
gaagacttagaaagaaaatatgaggacaatcaaaaatacttagaagataaagctcaagaa
ttggtgcgactggaaggagaggttcgctccctccttaaggacataagtgagaaagttgcg
gtttacagcacctgcttataa

DBGET integrated database retrieval system