KEGG   Mus musculus (mouse): 16785Help
Entry
16785             CDS       T01002                                 

Gene name
Rpsa, 67kDa, 67lr, AL022858, Lamr, Lamr1, Lamrl1, MLR, P40, P40-3, P40-8
Definition
(RefSeq) ribosomal protein SA
  KO
K02998  small subunit ribosomal protein SAe
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    16785 (Rpsa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    16785 (Rpsa)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    16785 (Rpsa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 40S_SA_C Ribosomal_S2
Motif
Other DBs
NCBI-GeneID: 16785
NCBI-ProteinID: NP_035159
MGI: 105381
Ensembl: ENSMUSG00000032518
Vega: OTTMUSG00000062571
UniProt: P14206
Position
9 F4; 9 71.41 cM
AA seq 295 aa AA seqDB search
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLL
AARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPR
LLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAR
EVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTA
AQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTEWS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagcccttgacgtcctgcagatgaaggaggaggatgtcctcaaattccttgct
gcgggaacccacttaggtggcaccaaccttgactttcagatggagcagtacatctacaaa
aggaaaagtgacggtatctacatcataaacctgaagaggacctgggagaagctgttgctc
gcagctcgagctattgttgccatcgagaatcctgctgacgtcagcgtcatctcctccagg
aacactggccagcgagctgtgctgaagtttgctgctgccacaggagccactccgatcgct
ggccgcttcacacctgggaccttcactaaccagatccaagcagccttcagggagccacgg
cttctagtggtgaccgatcccagggctgaccatcagccactcacagaggcctcttatgtc
aacctgcccaccattgctctgtgtaacacagattctcccctgcgctatgtggacattgcc
atcccatgcaacaacaagggagctcactcagtgggtctgatgtggtggatgctggccagg
gaagtactccgcatgcgaggtactatctcccgtgagcacccctgggaggtcatgcctgat
ctttacttctacagagacccagaggagattgagaaggaggagcaggctgctgctgagaag
gctgtgaccaaggaggaattccagggtgaatggaccgcaccagctcctgagttcactgct
gctcagcctgaggtggccgactggtctgagggtgtgcaggttccctctgtgcccatccag
cagttccccacggaagactggagtgcacagccagccactgaggattggtcagcagctccc
acagcgcaggccactgagtgggttggagccaccactgagtggtcctga

DBGET integrated database retrieval system