KEGG   Mus musculus (mouse): 16790
Entry
16790             CDS       T01002                                 

Gene name
Anpep, AP-M, AP-N, Apn, Cd13, P150
Definition
(RefSeq) alanyl (membrane) aminopeptidase
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu04614  Renin-angiotensin system
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    16790 (Anpep)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16790 (Anpep)
  09152 Endocrine system
   04614 Renin-angiotensin system
    16790 (Anpep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16790 (Anpep)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16790 (Anpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16790 (Anpep)
   04090 CD molecules [BR:mmu04090]
    16790 (Anpep)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     16790 (Anpep)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M1
   16790 (Anpep)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    16790 (Anpep)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   16790 (Anpep)
CD molecules [BR:mmu04090]
 Proteins
  16790 (Anpep)
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N DUF5700
Other DBs
NCBI-GeneID: 16790
NCBI-ProteinID: NP_032512
MGI: 5000466
Ensembl: ENSMUSG00000039062
Vega: OTTMUSG00000022543
UniProt: P97449
Position
7; 7 D2
AA seq 966 aa
MAKGFYISKTLGILGILLGVAAVCTIIALSVVYAQEKNRNAENSATAPTLPGSTSATTAT
TTPAVDESKPWNQYRLPKTLIPDSYRVILRPYLTPNNQGLYIFQGNSTVRFTCNQTTDVI
IIHSKKLNYTLKGNHRVVLRTLDGTPAPNIDKTELVERTEYLVVHLQGSLVEGRQYEMDS
QFQGELADDLAGFYRSEYMEGDVKKVVATTQMQAADARKSFPCFDEPAMKAMFNITLIYP
NNLIALSNMLPKESKPYPEDPSCTMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIG
IWARPSAIDEGQGDYALNVTGPILNFFAQHYNTSYPLPKSDQIALPDFNAGAMENWGLVT
YRESSLVFDSQSSSISNKERVVTVIAHELAHQWFGNLVTVAWWNDLWLNEGFASYVEYLG
ADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSSPADEIKTPDQIMELFDSITYSKGA
SVIRMLSSFLTEDLFKKGLSSYLHTYQYSNTVYLDLWEHLQKAVNQQTAVQPPATVRTIM
DRWILQMGFPVITVNTNTGEISQKHFLLDSKSNVTRPSEFNYIWIAPIPFLKSGQEDHYW
LDVEKNQSAKFQTSSNEWILLNINVTGYYLVNYDENNWKKLQNQLQTDLSVIPVINRAQI
IHDSFNLASAKMIPITLALDNTLFLVKEAEYMPWQAALSSLNYFTLMFDRSEVYGPMKRY
LKKQVTPLFFYFQNRTNNWVNRPPTLMEQYNEINAISTACSSGLKECRDLVVELYSQWMK
NPNNNTIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRNATLVNEADKLRSALACSKDVWIL
NRYLSYTLNPDYIRKQDTTSTIISIASNVAGHPLVWDFVRSNWKKLFENYGGGSFSFANL
IQGVTRRFSSEFELQQLEQFKADNSATGFGTGTRALEQALEKTRANIDWVKENKDAVFKW
FTENSS
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggccaaggggttctacatttccaagaccctgggcatcttgggcatcctgttgggtgtg
gcagctgtgtgtaccatcatagctctgtcggtggtctacgctcaggagaagaataggaat
gcagagaactctgccacagcccccacgctcccgggcagcacctcagccaccaccgcaacc
accacccctgctgtagatgaaagcaagccttggaaccagtatcgcttgcctaagactctt
atacctgactcctaccgggtgatcctgagaccctacctcacccccaacaatcagggcctg
tacatcttccaaggcaacagtactgttcgctttacctgcaaccagaccacggatgtcatt
atcatccacagcaaaaagctcaactacaccctcaaaggaaaccacagggtggtgttgcga
accctggacggcactccggcacctaacattgacaaaacggaactggtagagcgtactgag
tacctggtggtgcacctgcaggggtccctggtagagggccgtcagtacgagatggacagc
cagttccagggggaactggctgatgacctggctggcttctaccgcagcgagtacatggaa
ggagacgtcaagaaagtggtggctacaacgcagatgcaggctgctgatgctcggaaatcc
tttccatgttttgatgagccagccatgaaggccatgttcaacatcacactcatctacccc
aacaacctcatagctctgtctaatatgcttcccaaagagtccaagccctatccggaagac
ccttcctgcaccatgactgagttccactccacccctaagatgtccacatacctgctggcc
tacatcgtgagcgagttcaaaaatataagctccgtctcagccaatggtgtccagattgga
atctgggctcggcccagtgccattgatgagggccagggtgattacgcactgaacgttaca
ggccccatcctaaatttctttgcccaacattataatacatcctaccctctaccaaagtct
gaccagattgccctgcctgacttcaacgctggagccatggagaactggggtctggtgacc
taccgtgagagctccctggtctttgactctcagtcctcctccattagcaacaaggagcgg
gtggtcactgtgattgctcacgagctggcccatcagtggtttggcaacctggtgactgtg
gcttggtggaatgatctgtggctgaacgagggctttgcctcctacgtggaatatctgggt
gctgactatgcagagcctacctggaatctgaaagacctcatggtactgaatgatgtgtac
cgtgtgatggccgtggatgcccttgcctcctcccacccactgtccagtcctgctgacgag
atcaaaacaccagaccagatcatggagctgtttgacagcatcacctacagcaagggagcc
tcagtcatcaggatgctgtccagtttcctgacagaggacctgtttaagaagggcctttca
tcttatctccacacctaccagtactcgaacaccgtttatctggacctgtgggaacacctg
caaaaggccgtgaaccaacagacagctgtccaacccccggccacggtgcgcactatcatg
gaccgctggattctacagatgggctttcccgttatcactgtgaacaccaatacaggagaa
atctcccagaaacacttcctcctggattccaagtccaacgttacccgcccctccgagttt
aattacatctggatcgcgcccattccatttctcaaaagtggacaggaggatcactactgg
ctggatgtcgagaaaaaccagagtgcaaagttccagacatcctccaatgaatggatctta
ctgaacattaacgtaaccggctactacctggttaactatgatgagaacaactggaagaag
cttcagaatcagctgcaaacagacctttctgttatccctgtcatcaaccgagcacagatt
atccacgactccttcaacctggccagtgctaaaatgatacccatcaccctggcgctggac
aacaccctcttcctggtcaaagaggcggagtacatgccctggcaggctgccctgagcagc
ctcaactacttcacactcatgttcgaccgctcggaggtctacggccccatgaagaggtat
ctgaagaagcaagttacgcccctcttcttctacttccaaaatagaaccaacaactgggtc
aaccgtcctccaacgctgatggagcagtacaatgaaattaacgccatcagcaccgcctgt
tccagtggtctcaaagagtgtagggacctggtcgttgagctctatagtcagtggatgaaa
aaccctaataataacacgatccaccccaaccttcggtctactgtctactgcaatgccatt
gctttcggtggcgaagaagagtggaactttgcttgggaacagttccggaatgcaactctg
gtgaacgaagcggacaaactccggtcagccttggcctgtagcaaagatgtgtggattttg
aacaggtacctgagttacactctgaacccggactacatccggaagcaggacaccacctcc
accatcatcagcattgccagcaacgtggctgggcaccctctggtttgggactttgtccga
agcaactggaagaaactgtttgagaattacggtggaggatctttctcctttgccaatctc
atccagggagtgacccggcgcttctcctctgagttcgagctgcagcagctggagcagttt
aaagcggataactcagccacaggctttggcaccggcactcgggctctggagcaagccctg
gagaagacgagagccaacatcgactgggtgaaggagaacaaagatgcggtattcaagtgg
ttcacagagaacagcagttag

DBGET integrated database retrieval system