KEGG   Mus musculus (mouse): 16792
Entry
16792             CDS       T01002                                 

Symbol
Laptm5, E3, Stra13
Name
(RefSeq) lysosomal-associated protein transmembrane 5
  KO
K12387  lysosomal-associated transmembrane protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    16792 (Laptm5)
SSDB
Motif
Pfam: Mtp DUF4728
Other DBs
NCBI-GeneID: 16792
NCBI-ProteinID: NP_034816
MGI: 108046
Ensembl: ENSMUSG00000028581
Vega: OTTMUSG00000009589
UniProt: Q61168 Q544S4
Position
4:130640627..130663459
AA seq 261 aa
MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRM
ADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY
LKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPH
SQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE
ALSLPPKTPEGDPAPPPYSEV
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcctcccgtgcagcgccggtcagacagacatgctgttgtttcaacatccgagtcgcc
accatagccctggccatttaccacatagtcatgagtgtcctgctgttcattgagcatgtg
gtggaggtggcccgcggtaaagtgtcctgtaggttcttcaagatgccgtacctcaggatg
gctgacctgctctccagcttcctgctcattggcgtgctcttcatcatcagcatcagcctg
ctgttcggcgtggtcaagaaccgggagaagtacctgatacccttcctgtcccttcaaatc
atggacttcctgctctgcctgctcacactgctgggctcctacatcgaattgccagcgtac
ttgaagcttgcccggccccggcctggtccttctaaggtccccttgatgacactgcagctg
ctagacttctgtttgagtatcctgaccctgtgcagctcctacatggaagtgcccacctac
ctcaacttcaagtccatgaaccacatgaattacctcccaagccaggagggtgtgccgcac
agccagttcatcaacatgatgctcatcttctcagtggcctttatcaccgtgctcatcctg
aaggtctacatgttcaagtgtgtgtacacatgctacaaattcttgaagcacatgaattcg
gccatggaggacagcagctccaagatgttcctcaaggtggctctgccgtcctacgaggaa
gccttgtctctgccccctaagactccagagggggaccctgcaccacccccatactcagaa
gtgtga

DBGET integrated database retrieval system