KEGG   Mus musculus (mouse): 16797Help
Entry
16797             CDS       T01002                                 

Gene name
Lat, p36-38, pp36
Definition
(RefSeq) linker for activation of T cells
  KO
K07362  linker for activation of T cells
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    16797 (Lat)
   04015 Rap1 signaling pathway
    16797 (Lat)
   04064 NF-kappa B signaling pathway
    16797 (Lat)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16797 (Lat)
   04660 T cell receptor signaling pathway
    16797 (Lat)
   04658 Th1 and Th2 cell differentiation
    16797 (Lat)
   04659 Th17 cell differentiation
    16797 (Lat)
   04664 Fc epsilon RI signaling pathway
    16797 (Lat)
   04666 Fc gamma R-mediated phagocytosis
    16797 (Lat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAT
Motif
Other DBs
NCBI-GeneID: 16797
NCBI-ProteinID: NP_034819
MGI: 1342293
Ensembl: ENSMUSG00000030742
Vega: OTTMUSG00000058212
UniProt: O54957 Q546H1
Position
7; 7 F3
AA seq 242 aa AA seqDB search
MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVP
RTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPAC
KNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPE
SEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQE
LN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagacgccttgagcccggtggggctgggcctcctgctgctgcccttcttggtc
acgctcctggctgccctgtgcgtgcgctgccgtgagttgccagtctcctatgacagcact
tccacagagagtttgtacccaagaagcatcctcatcaagccacctcaaataaccgtcccc
cgaacacctgctgtttcctaccctctagtcacttccttcccacccctgaggcagccagac
ctgctccccatcccgagatccccacagccccttgggggttcccatcggatgccatcttcc
cagcagaattcagatgatgccaacagtgtggcaagctacgagaaccaggagccagcctgt
aagaatgtggatgcagatgaggatgaagacgactatcccaacggctacctagtggtgctg
cctgacagtagtcctgctgccgtccctgttgtctcctctgctcctgtgcctagcaaccct
gaccttggagacagtgccttctctgtggagtcgtgtgaagattacgtgaatgttcctgag
agtgaggagagcgcagaggcgtctctggatgggagccgggagtatgtgaatgtgtcccca
gagcagcagccagtgaccagggctgagctggcctctgtgaactcccaggaggtggaagac
gaaggagaagaggaaggggtggatggagaggaagctcctgactatgagaatctgcaggag
cttaactga

DBGET integrated database retrieval system