KEGG   Mus musculus (house mouse): 16798
Entry
16798             CDS       T01002                                 
Symbol
Lats1, AW208599
Name
(RefSeq) large tumor suppressor
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    16798 (Lats1)
   04392 Hippo signaling pathway - multiple species
    16798 (Lats1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16798 (Lats1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16798 (Lats1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  NDR family
   16798 (Lats1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr UBA ABC1 Cas_Cas6_C APH Kinase-like Pkinase_C Haspin_kinase EcoEI_R_C Pox_ser-thr_kin UBA_3
Other DBs
NCBI-GeneID: 16798
NCBI-ProteinID: NP_034820
MGI: 1333883
Ensembl: ENSMUSG00000040021
UniProt: Q8BYR2
Structure
Position
10:7556964..7592225
AA seq 1129 aa
MKRGEKPEGYRQMRPKTFPASNYPGSSRQMLQEIRESLRNLSKPSDASKAEHNLNKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETSSSRSPSEVNPQMFQDLQAAGFDEDMVI
QALQKTNNRSIEAAVEFISKMSYQDPRREQMSAAAARPINATMKPGNVQHSINRKQSWKG
SKESLVPQRHGPSLGENVVYRSESPNSQADVGRPLSGSGIAAFAQAHPSNGQRVNPPPPP
QVRSVTPPPPPRGQTPPPRGTTPPPPSWEPSSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLTTSPMNPPSQAQRAISSVPVGRQPIIMQSTSKFNFTPGRPGVQNGGGQSDFIVHQ
NVPTGSVTRQPPPPYPLTPANGQSPSALQTGASAAPPSFANGNVPQSMMVPNRNSHNMEL
YNINVPGLQTAWPQSSSAPAQSSPSGGHEIPTWQPNIPVRSNSFNNPLGSRASHSANSQP
SATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWMPQPVQTVQPTPFSEGTASSVP
VIPPVAEAPSYQGPPPPYPKHLLHQNPSVPPYESVSKPCKDEQPSLPKEDDSEKSADSGD
SGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRK
KQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCL
ARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFV
MDYIPGGDMMSLLIRMGIFPENLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGH
IKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSNCRCGDRLKPLERRAARQ
HQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMK
VINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQ
QSASYIPKITHPTDTSNFDPVDPDKLWSDGSEEENISDTLNGWYKNGKHPEHAFYEFTFR
RFFDDNGYPYNYPKPIEYEYIHSQGSEQQSDEDDQHTSSDGNNRDLVYV
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgaagaggggtgaaaagccagaagggtacagacagatgaggcctaagacctttcctgcc
agcaactaccctggcagcagccgacagatgctgcaggagatccgagaatccctgaggaat
ttatcaaaaccatctgatgcttcgaaggccgagcataacctgaataagatgtcgactgaa
gatcccaggcaggtgagaaatccacccaaatttggcacacatcataaagccttgcaagaa
attcgaaactctctactaccatttgcaaatgaaacaagttcttcccggagcccttcagaa
gttaatccacagatgtttcaggatttgcaggctgctggctttgatgaggacatggttatt
caagctcttcagaaaaccaataacagaagcatagaagccgctgttgaattcattagtaaa
atgagttaccaagaccctcgtcgagagcagatgtctgcagcagctgccaggcctattaat
gccaccatgaaaccaggaaatgtgcaacattcaattaaccgaaaacaaagctggaaaggt
tctaaagagtctctagttcctcagagacacggcccatctctaggagaaaatgtggtttat
cgttctgaaagccccaactcacaggcggatgtaggaagacctctgtctggatccggcatt
gcagcatttgctcaagctcacccaagcaatggacagagagtgaaccccccaccaccacct
caagttaggagtgttactcctccaccacctccgagaggccagaccccacctccccgaggc
accactccccctcccccctcatgggaaccaagctctcagacaaagcgctactctgggaac
atggagtacgtaatctcccgaatctcccctgttccacctggggcgtggcaggagggctac
cctccaccacctcttaccacttctcccatgaatccccctagccaggctcagagggccatt
agttctgttccagttggtagacaacccatcatcatgcagagtactagcaaatttaacttt
acaccagggcgacctggagttcagaatggtggtggtcagtctgattttatcgtgcaccaa
aatgtccccactggttctgtgactcggcagccaccacctccatatcctctgaccccagct
aatggacaaagcccctctgctttacaaacaggggcttctgctgctccaccatcattcgcc
aatggaaacgttcctcagtcgatgatggtgcccaacaggaacagtcataacatggagctt
tataatattaatgtccctggactgcaaacagcctggccccagtcgtcttctgctcctgcg
cagtcatccccaagcggtgggcatgaaattcctacatggcaacctaacataccagtgagg
tcaaattcttttaataacccattaggaagtagagcaagtcactctgctaattctcagcct
tctgccactacagtcactgccatcacacccgctcctattcaacagcccgtgaaaagcatg
cgcgtcctgaaaccagagctgcagactgctttagccccaacccatccttcttggatgcca
cagccagttcagactgttcagcctacccctttttctgagggtacagcttcaagtgtgcct
gtcatcccacctgttgctgaagctccaagctatcaaggtccaccaccgccttatccaaaa
catctgctacaccaaaacccatctgtccctccatatgagtcagtaagtaagccctgcaaa
gatgaacagcctagcttacccaaggaagatgatagtgagaagagtgcggacagtggtgac
tctggggataaagaaaagaaacagattacaacttcacctatcactgttcggaaaaacaag
aaagatgaagaacgaagagagtctcggattcagagttactccccacaggcctttaagttc
ttcatggagcagcacgtagagaacgtcctgaagtctcatcagcagcgtctgcatcggaag
aagcagctagaaaatgaaatgatgcgggttggattatctcaagatgcccaggatcaaatg
agaaagatgctttgccagaaagagtctaactatattcgtcttaaaagggctaaaatggac
aagtctatgtttgtaaagataaagacattaggaataggagcgtttggtgaagtctgtcta
gcaagaaaagtcgatactaaagctttgtatgcaacaaagactcttcgaaagaaagacgtt
ctgctccgaaatcaggtggctcatgtgaaagcggagagggatatcctagcagaagccgac
aatgagtgggtggtccgcctgtactactctttccaggacaaggacaacttgtactttgtg
atggactacattcctgggggggatatgatgagcctattaattagaatgggcatctttcct
gaaaatctggcacgattctacatagcagaacttacctgtgcagttgaaagtgttcataaa
atgggttttattcatagagatattaaacctgataacattttgattgaccgtgatggccat
attaaattgactgactttggcttgtgcactggcttcagatggacacatgactccaagtac
taccagagtggggatcacccacggcaagatagcatggatttcagtaacgaatggggagat
ccttccaattgtcggtgtggggacagactgaagccactggagcggagagctgctcgccag
caccagcgatgtctagcccattctctggttgggactcccaattatattgcacctgaagtg
ctactgcgaacaggatatacacagctgtgtgactggtggagtgttggtgttattcttttt
gaaatgttggtgggacaacctcctttcttggcacaaaccccattagaaacacaaatgaag
gttatcaactggcaaacttctcttcacatccctcctcaagctaagctgagtcctgaagcc
tctgacctcattatcaaactttgtcgaggaccagaagaccgcctcggcaagaacggtgct
gatgagataaaggctcatccattttttaagaccatcgatttctctagtgatctgagacag
cagtctgcttcatacatccctaaaatcacgcatccaacagatacatccaatttcgaccct
gttgatcctgataaattgtggagcgatggcagcgaggaggaaaatatcagtgacactctg
aacggatggtataaaaatgggaagcaccccgagcacgctttctatgagttcacctttcgg
aggttttttgatgacaatggctacccatataattatccaaagcctattgagtatgaatac
attcattcacagggctcagaacaacagtctgatgaagatgatcaacacacaagctccgat
ggaaacaaccgagatctagtgtatgtttaa

DBGET integrated database retrieval system