KEGG   Mus musculus (mouse): 16819
Entry
16819             CDS       T01002                                 

Symbol
Lcn2, 24p, 24p3, AW212229, N, NRL, Sip24
Name
(RefSeq) lipocalin 2
  KO
K21129  lipocalin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    16819 (Lcn2)
SSDB
Motif
Pfam: Lipocalin VDE Lipocalin_2
Other DBs
NCBI-GeneID: 16819
NCBI-ProteinID: NP_032517
MGI: 96757
Ensembl: ENSMUSG00000026822
Vega: OTTMUSG00000012958
UniProt: P11672
Structure
PDB: 
3S26 3U9P

Position
2 B; 2 22.09 cM
AA seq 200 aa
MALSVMCLGLALLGVLQSQAQDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNA
VQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMH
RYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKS
LGLKDDNIIFSVPTDQCIDN
NT seq 603 nt   +upstreamnt  +downstreamnt
atggccctgagtgtcatgtgtctgggccttgccctgcttggggtcctgcagagccaggcc
caggactcaactcagaacttgatccctgccccatctctgctcactgtccccctgcagcca
gacttccggagcgatcagttccggggcaggtggtacgttgtgggcctggcaggcaatgcg
gtccagaaaaaaacagaaggcagctttacgatgtacagcaccatctatgagctacaagag
aacaatagctacaatgtcacctccatcctggtcagggaccaggaccagggctgtcgctac
tggatcagaacatttgttccaagctccagggctggccagttcactctgggaaatatgcac
aggtatcctcaggtacagagctacaatgtgcaagtggccaccacggactacaaccagttc
gccatggtatttttccgaaagacttctgaaaacaagcaatacttcaaaattaccctgtat
ggaagaaccaaggagctgtcccctgaactgaaggaacgtttcacccgctttgccaagtct
ctgggcctcaaggacgacaacatcatcttctctgtccccaccgaccaatgcattgacaac
tga

DBGET integrated database retrieval system