KEGG   Mus musculus (mouse): 16822
Entry
16822             CDS       T01002                                 

Gene name
Lcp2, AI323664, BB161688, SL, SLP, SLP-76, SLP76, m1Kho, m1Khoe, twm
Definition
(RefSeq) lymphocyte cytosolic protein 2
  KO
K07361  lymphocyte cytosolic protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04380  Osteoclast differentiation
mmu04611  Platelet activation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16822 (Lcp2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    16822 (Lcp2)
   04650 Natural killer cell mediated cytotoxicity
    16822 (Lcp2)
   04660 T cell receptor signaling pathway
    16822 (Lcp2)
   04664 Fc epsilon RI signaling pathway
    16822 (Lcp2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16822 (Lcp2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16822 (Lcp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    16822 (Lcp2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   16822 (Lcp2)
SSDB
Motif
Pfam: SH2 SAM_2
Other DBs
NCBI-GeneID: 16822
NCBI-ProteinID: NP_034826
MGI: 1321402
Ensembl: ENSMUSG00000002699
Vega: OTTMUSG00000005404
UniProt: Q60787
Position
11; 11 A4
AA seq 533 aa
MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGGWSSFEDDYESPNDDDP
DGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPPNSFHNTNSMYIDRPPTG
KVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPNHEEPSRSGNNKTAKLPAPSIDRSTK
PPLDRSLAPLDREPFILGKKPPFSDKPSAPLGREHLPKIQKPPLPPAMDRHERNERLGPV
TTRKPPVPRHGRGPDRRENDEDDVHQRPLPQPSLPSMSSNTFPSRSVQPSSKNTFPLAHM
PGAFSESNIGFQQSASLPPYFSQGPGNRPPLRSEGRNLPLPVPNRPQPPSPGEEETPLDE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNPYVLMVLYKDKVYNIQIRYQEES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGCL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggccttgaagaatgtcccgtttcgctcagaggtcctagcctggaactcagacaacctc
gctgactatttcaggaagctgaactacagggactgtgagaaggctgtgaagaaataccac
attgatggtgctcggtttttgaacctgacagaaaatgacattcagaagttccctaagctg
aggatgccacttctcagtaagttgagtcaagatatcaacaagaacgaagagagaaggagc
attttcacacgcaaaccccagattccacggtttcttgaggagacagaaagccacgaagaa
gacgatggtggctggtcatcctttgaagatgactatgaaagtcccaatgatgatgatcca
gatggggaggacgatggtgactatgagtcccctaatgaggaggaacaggccctggtggac
gatgctgctgactatgagcctccaccctccaacaacgaggaggctctgcagagctccatc
ctgccccccaactctttccacaacaccaactccatgtacatcgaccgacctcccactggc
aaggtctcccagcagcctccagtgcccccactgagaccaaaacctgccctccctcccctg
ccaacaggcaggaatcactcgccactgtctccaccccatcccaaccacgaagagcccagc
agaagtggaaacaacaagacagcaaagttgcctgctccatcaatagacagaagcacaaaa
cctcccctggaccgctcactggcccctcttgaccgagagcccttcatactaggaaagaaa
ccaccattttctgataagccctcagccccattggggagggaacatttacccaagatacaa
aagcctcctttgccaccagccatggacagacacgaaagaaatgaaagactcggacccgtg
acaacgaggaagccaccagttccaaggcatggaaggggaccagacagaagagagaatgat
gaagatgatgtgcatcagagacctttgccacagccgtcactaccttccatgagctccaac
acattcccttcgagatctgtccagcccagctccaagaacacattcccattggcccacatg
ccgggagccttctcagaaagcaacattggctttcagcagagtgcctccctgccgccatac
ttctctcaaggtccaggcaacaggccacctctcagaagtgaaggcagaaacttacccttg
ccggttccaaacaggcctcagcctccatctcctggggaagaagagacacccttagatgaa
gagtggtatgtctcttatatcacccgaccagaggcagaagctgctctgaggaagataaac
caggatggcaccttcctggttagagacagctctaagaagacagcgaacaatccgtatgtc
ctcatggtgctgtacaaagacaaagtttacaacatccaaatccgctaccaggaggaaagt
caagtctacttgttgggcactggacttcgaggaaaagaggacttcctgtctgtatcagat
attattgactacttcaggaaaatgccgctgttgctcattgatggaaagaatcgagggtcc
agataccagtgcacactaacacacgctgcaggctgtctgtag

DBGET integrated database retrieval system