KEGG   Mus musculus (mouse): 16826Help
Entry
16826             CDS       T01002                                 

Gene name
Ldb2, AI035351, AW146358, CLIM1, CLP-36, Ldb3
Definition
(RefSeq) LIM domain binding 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LIM_bind LID zf-DNL
Motif
Other DBs
NCBI-GeneID: 16826
NCBI-ProteinID: NP_034828
MGI: 894670
Ensembl: ENSMUSG00000039706
Vega: OTTMUSG00000053817
UniProt: O55203
Position
5; 5 B3
AA seq 373 aa AA seqDB search
MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFE
DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDC
DQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQD
PQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQ
RMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGSKKKTPAASLSLATQVPDVM
VVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQ
ETKSENAPPQASQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcacaccacatgaccccttctattcttctcctttcggcccattttataggaga
catacaccatacatggtacagccagagtaccgaatctatgagatgaacaagagactgcag
tctcgtacagaggacagtgacaacctctggtgggatgcgtttgccactgaattttttgaa
gatgatgccacattaacactttcattttgtttggaagacggaccaaagcgatacactatc
ggcaggaccctcattccccgttattttagcaccgtatttgaaggaggggtgacagacctg
tactacatccttaaacactcaaaggagtcatatcacaactcatccatcacagtagactgc
gaccagtgtgccatggtcacacagcatgggaagcccatgtttaccaaggtatgcacagaa
ggcaggctgatcttggaattcacatttgatgacctcatgagaataaaaacgtggcacttt
accattagacagtacagggagctggtccccagaagcatactagccatgcacgcacaagat
cctcaggtcctggatcagctgtccaaaaatatcaccaggatgggtctcacaaacttcacc
ctcaactacctcaggttgtgtgtaatactggagccaatgcaggaactgatgtcgagacac
aaaacctacaacctcagtccccgagactgcctgaagacctgtctgtttcagaagtggcag
cggatggtggccccgccagcagaacccacaaggcaaccgacaaccaaaaggagaaaacga
aaaaactccacaagcagcacgtccaatagcagtgccgggaacacgaccaacagtgccggc
agcaagaagaagaccccggcggcaagcctgagcctggccactcaggtacctgatgtgatg
gtggtaggagagccaactctgatgggaggtgagtttggggacgaggacgaaaggctaatc
actagattagaaaacacgcagtatgatgcggccaacggcatggacgacgaagaagacttc
aacaattcacctgccctggggaacaacagcccgtggaacagtaaacctcccgccacgcaa
gagaccaaatcagaaaacgccccaccccaggcttcccagtaa

DBGET integrated database retrieval system