KEGG   Mus musculus (house mouse): 16828
Entry
16828             CDS       T01002                                 
Symbol
Ldha, Ldh1, Ldhm, l7R2
Name
(RefSeq) lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    16828 (Ldha)
   00620 Pyruvate metabolism
    16828 (Ldha)
   00640 Propanoate metabolism
    16828 (Ldha)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    16828 (Ldha)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    16828 (Ldha)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    16828 (Ldha)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    16828 (Ldha)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16828 (Ldha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     16828 (Ldha)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16828 (Ldha)
  Exosomal proteins of breast milk
   16828 (Ldha)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Pyr_redox_2 Glyco_hydro_4 Glyco_hydro_4C
Other DBs
NCBI-GeneID: 16828
NCBI-ProteinID: NP_034829
MGI: 96759
Ensembl: ENSMUSG00000063229
UniProt: P06151 Q564E2
Position
7:46491698..46505051
AA seq 332 aa
MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGI
SDVVKVTLTPEEEARLKKSADTLWGIQKELQF
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcaaccctcaaggaccagctgattgtgaatcttcttaaggaagagcaggctccccag
aacaagattacagttgttggggttggtgctgttggcatggcttgtgccatcagtatctta
atgaaggacttggcggatgagcttgcccttgttgacgtcatggaagacaaactcaagggc
gagatgatggatctccagcatggcagcctcttccttaaaacaccaaaaattgtctccagc
aaagactactgtgtaactgcgaactccaagctggtcattatcaccgcgggggcccgtcag
caagagggggagagccggctcaacctggtccagcgaaacgtgaacatcttcaagttcatc
attcccaacattgtcaagtacagtccacactgcaagctgctgatcgtctccaatccagtg
gatatcttgacctacgtggcttggaaaatcagtggctttcccaaaaaccgagtaattgga
agtggttgcaatctggattcagcgcggttccgttacctgatgggagagaggctgggggtt
cacgcgctgagctgtcacggctgggtcctgggagaacatggcgactccagtgtgcctgtg
tggagtggtgtgaatgttgccggcgtctccctgaagtctcttaacccagaactgggcact
gacgcagacaaggagcagtggaaggaggttcacaagcaggtggtggacagtgcctacgag
gtgatcaagctgaaaggttacacatcctgggccattggcctctctgtggcagacttggct
gagagcataatgaagaaccttaggcgggtgcatcccatttccaccatgattaagggtctc
tatggaatcaatgaggatgtcttcctcagtgtcccatgtatcctgggacaaaatggaatc
tcggatgttgtgaaggtgacactgactcctgaggaagaggcccgcctgaagaagagcgca
gacaccctctggggaatccagaaggagctgcagttctaa

DBGET integrated database retrieval system