KEGG   Mus musculus (mouse): 16835Help
Entry
16835             CDS       T01002                                 

Gene name
Ldlr, Hlb301
Definition
(RefSeq) low density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04913  Ovarian steroidogenesis
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
mmu04976  Bile secretion
mmu04979  Cholesterol metabolism
mmu05145  Toxoplasmosis
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16835 (Ldlr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16835 (Ldlr)
   04925 Aldosterone synthesis and secretion
    16835 (Ldlr)
   04927 Cortisol synthesis and secretion
    16835 (Ldlr)
  09154 Digestive system
   04976 Bile secretion
    16835 (Ldlr)
   04979 Cholesterol metabolism
    16835 (Ldlr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    16835 (Ldlr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    16835 (Ldlr)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16835 (Ldlr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16835 (Ldlr)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    16835 (Ldlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL hEGF
Motif
Other DBs
NCBI-GeneID: 16835
NCBI-ProteinID: NP_034830
MGI: 96765
Ensembl: ENSMUSG00000032193
Vega: OTTMUSG00000063513
UniProt: P35951
Position
9 A3; 9 7.87 cM
AA seq 862 aa AA seqDB search
MSTADLMRRWVIALLLAAAGVAAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESP
ETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDGK
CISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEW
PQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPD
EFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSA
RDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQ
EPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEY
TSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLA
VDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILE
DENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQ
PRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVL
TTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGR
GNEEQPHGMRFLSIFFPIALVALLVLGAVLLWRNWRLKNINSINFDNPVYQKTTEDELHI
CRSQDGYTYPSRQMVSLEDDVA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcggatctgatgcgtcgctgggtcatcgccctgctcctggctgctgccgga
gttgcagcagaagactcatgcagcaggaacgagttccagtgtagagacggaaaatgcatc
gctagcaagtgggtgtgcgatggcagccccgagtgcccggatggctccgatgagtcccca
gagacatgcatgtctgtcacctgtcagtccaatcaattcagctgtggaggccgtgtcagc
cgatgcattcctgactcctggagatgtgatggacaggtagactgtgaaaatgactcagac
gaacaaggctgtccccccaagacgtgctcccaggatgacttccgatgccaggatggcaag
tgcatctccccgcagtttgtgtgtgatggagaccgagattgcctagatggctctgatgag
gcccactgccaggccaccacttgtggccccgcccacttccgctgcaactcatccatatgc
atccccagtctttgggcctgcgacggggatgtcgactgtgttgacggctccgatgagtgg
ccacagaactgccagggccgagacacggcctccaaaggcgttagcagcccctgctcctcc
ctggagttccactgtggtagcagtgagtgtatccatcgcagctgggtctgtgacggcgag
gcagactgcaaggacaagtcagatgaggagcactgcgcggtggccacctgccgacctgat
gaattccagtgtgcagatggctcctgcattcacggtagccgccagtgtgaccgtgaacat
gactgcaaggacatgagcgacgagctcggctgcgtcaatgtgacacagtgtgatggcccc
aacaagttcaagtgtcacagtggggagtgcatcagcttggacaaggtgtgcgactccgcc
cgcgactgccaggactggtcggatgagcccatcaaggagtgcaagaccaacgagtgtttg
gacaacaatggtggctgttcccacatctgcaaggacctcaagattggctctgagtgcctg
tgtcccagcggcttccggttggtggacctccacaggtgtgaagatattgacgagtgtcag
gagccagacacctgcagccagctctgtgtgaacctggaaggcagctacaagtgtgagtgc
caggccggcttccacatggacccacacaccagggtctgcaaggctgtgggctccataggc
tatctgctcttcaccaaccgccacgaggtccggaagatgaccctggaccgcagcgagtac
accagtctgctccccaacctgaagaatgtggtggctctcgacacggaggtgaccaacaat
agaatctactggtccgacctgtcccaaaaaaagatctacagcgccctgatggaccaggcc
cctaacttgtcctacgacaccatcatcagtgaggacctgcatgcccctgacgggctggcg
gtagactggatccaccgcaacatctactggacagattcagtcccaggcagcgtatctgtg
gctgacaccaagggcgtaaagaggaggacactgttccaagaggcagggtccagacccaga
gccatcgtagtggaccctgtgcatggcttcatgtactggacagattggggaacacccgcc
aagatcaagaaagggggtttgaatggtgtggacatccactcactggtgaccgaaaacatc
cagtggccaaatggcatcacactagatctttccagtggccgtctctattgggttgattcc
aaactccactctatctccagcatcgatgtcaatgggggcaatcggaaaaccattttggag
gatgagaaccggctggcccaccccttctccttggccatctatgaggacaaagtgtattgg
acagatgtcataaacgaagccattttcagtgccaatcgactcacgggttcagatgtgaat
ttggtggctgaaaacctcttgtccccggaggacattgtcctgttccacaaggtcacacag
cctagaggggtgaactggtgtgagacaacagccctcctccccaatggtggttgccagtac
ctgtgcctgcccgccccacagatcggtccccactcgcccaaattcacctgcgcctgccct
gatggcatgctgctggccaaggacatgcggagctgcctcacagaagtcgacactgtactg
accacccaggggacatccgccgtccggcctgtggtcaccgcatcagctaccaggccaccg
aagcacagtgaggatctctcagctcccagtactcctaggcagcctgtggacaccccaggg
ctcagcacagtggcgtcagtgacagtgtcccaccaagtccagggtgacatggctggcaga
gggaatgaggagcagccacatggtatgaggttcctgtccatcttcttccctattgcactg
gttgccctccttgtccttggggccgtcctgctgtggaggaactggcggctgaagaacatc
aacagcataaactttgacaacccagtctaccagaagaccacagaggacgagctccacatt
tgccgaagccaggatggctatacctacccctcaagacagatggtcagcctggaggacgat
gtggcatga

DBGET integrated database retrieval system