KEGG   Mus musculus (mouse): 16841Help
Entry
16841             CDS       T01002                                 

Gene name
Lect2
Definition
(RefSeq) leukocyte cell-derived chemotaxin 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 16841
NCBI-ProteinID: NP_034832
MGI: 1278342
Ensembl: ENSMUSG00000021539
UniProt: O88803 A0A0R4J0R8
Position
13 B1; 13 30.08 cM
AA seq 151 aa AA seqDB search
MIPTTILISAALLSSALAGPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLC
SDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKL
GTLLPLQKVYPGIQSHVHVENCDSSDPTAYL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgattcccacaacaatcctcatttcagctgctttgctttcctctgccctagcaggacca
tgggctaacatatgtgccagcaaatcttccaacgagatccggacgtgtgacagctatggc
tgtggacagtactctgctcaaagaacccaaaggcatcacccaggtgtggacgtcctgtgc
tcggatggatctgtggtgtatgcaccattcactgggaagatagtgggccaggagaaaccc
tatagaaacaaaaatgccatcaatgatggcattcgactgtctggaagaggtttttgtgtc
aaaattttctacattaagccaattaagtataaaggttctatcaaaaagggggagaagctg
ggcaccttgctgcccctgcagaaagtttacccgggcatccagtcgcatgtacacgttgaa
aactgcgactccagtgaccccacagcatacctgtaa

DBGET integrated database retrieval system