KEGG   Mus musculus (mouse): 16846
Entry
16846             CDS       T01002                                 

Gene name
Lep, ob, obese
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04152  AMPK signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16846 (Lep)
   04152 AMPK signaling pathway
    16846 (Lep)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    16846 (Lep)
   04060 Cytokine-cytokine receptor interaction
    16846 (Lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    16846 (Lep)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16846 (Lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16846 (Lep)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   16846 (Lep)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 16846
NCBI-ProteinID: NP_032519
MGI: 104663
Ensembl: ENSMUSG00000059201
Vega: OTTMUSG00000035815
UniProt: P41160 Q544U0
Position
6 A3.3; 6 12.3 cM
AA seq 167 aa
MCWRPLCRFLWLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL
DFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLP
QTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtgctggagacccctgtgtcggttcctgtggctttggtcctatctgtcttatgttcaa
gcagtgcctatccagaaagtccaggatgacaccaaaaccctcatcaagaccattgtcacc
aggatcaatgacatttcacacacgcagtcggtatccgccaagcagagggtcactggcttg
gacttcattcctgggcttcaccccattctgagtttgtccaagatggaccagactctggca
gtctatcaacaggtcctcaccagcctgccttcccaaaatgtgctgcagatagccaatgac
ctggagaatctccgagacctcctccatctgctggccttctccaagagctgctccctgcct
cagaccagtggcctgcagaagccagagagcctggatggcgtcctggaagcctcactctac
tccacagaggtggtggctttgagcaggctgcagggctctctgcaggacattcttcaacag
ttggatgttagccctgaatgctga

DBGET integrated database retrieval system