KEGG   Mus musculus (mouse): 16848
Entry
16848             CDS       T01002                                 

Gene name
Lfng, AW061165
Definition
(RefSeq) LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00514  Other types of O-glycan biosynthesis
mmu04330  Notch signaling pathway
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    16848 (Lfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    16848 (Lfng)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16848 (Lfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    16848 (Lfng)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     16848 (Lfng)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   16848 (Lfng)
SSDB
Motif
Pfam: Fringe Fur_reg_FbpA Galactosyl_T
Other DBs
NCBI-GeneID: 16848
NCBI-ProteinID: NP_032520
MGI: 1095413
Ensembl: ENSMUSG00000029570
Vega: OTTMUSG00000054831
UniProt: O09010 B2RRW2
Position
5 G2; 5 79.15 cM
AA seq 378 aa
MLQRCGRRLLLALVGALLACLLVLTADPPPTPMPAERGRRALRSLAGSSGGAPASGSRAA
VDPGVLTREVHSLSEYFSLLTRARRDADPPPGVASRQGDGHPRPPAEVLSPRDVFIAVKT
TRKFHRARLDLLFETWISRHKEMTFIFTDGEDEALAKLTGNVVLTNCSSAHSRQALSCKM
AVEYDRFIESGKKWFCHVDDDNYVNLRALLRLLASYPHTQDVYIGKPSLDRPIQATERIS
EHKVRPVHFWFATGGAGFCISRGLALKMGPWASGGHFMSTAERIRLPDDCTIGYIVEALL
GVPLIRSGLFHSHLENLQQVPTTELHEQVTLSYGMFENKRNAVHIKGPFSVEADPSRFRS
VHCHLYPDTPWCPRSAIF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgctccagcggtgcggccggcgcctgctgctggcgctggtgggcgcgctgttggcttgt
ctcctggtgctcacggccgacccgccaccgactccgatgcccgctgagcgcggacggcgc
gcgctgcgtagcctggcgggctcctctggaggagctccggcttcagggtccagggcggct
gtggatcccggagtcctcacccgcgaggtgcatagcctctccgagtacttcagtctactc
acccgcgcgcgcagagacgcggatccaccgcccggggtcgcttctcgccagggcgacggc
catccgcgtccccccgccgaagttctgtcccctcgcgacgtcttcatcgccgtcaagacc
accagaaagtttcaccgcgcgcggctcgatctgctgttcgagacctggatctcgcgccac
aaggagatgacgttcatcttcactgatggggaggacgaagctctggccaagctcacaggc
aatgtggtgctcaccaactgctcctcggcccacagccgccaggctctgtcctgcaagatg
gctgtggagtatgaccgattcattgagtctgggaagaagtggttctgccacgtggatgat
gacaactacgtcaacctccgggcgctgctgcggctcctggccagctatccccacacccaa
gacgtgtacatcggcaagcccagcctggacaggcccatccaggccacagaacggatcagc
gagcacaaagtgagacctgtccacttttggtttgccaccggaggagctggcttctgcatc
agccgagggctggccctaaagatgggcccatgggccagtggaggacacttcatgagcacg
gcagagcgcatccggctccccgatgactgcaccattggctacattgtagaggctctgctg
ggtgtacccctcatccggagcggcctcttccactcccacctagagaacctgcagcaggtg
cccaccaccgagcttcatgagcaggtgaccctgagctatggcatgtttgagaacaagcgg
aacgcagtgcacatcaagggaccattctctgtggaagctgacccatccaggttccgctct
gtccattgccacctgtacccagacacaccctggtgtcctcgctccgccatcttctag

KEGG   Mus musculus (mouse): 17305
Entry
17305             CDS       T01002                                 

Gene name
Mfng, AW546563
Definition
(RefSeq) MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00514  Other types of O-glycan biosynthesis
mmu04330  Notch signaling pathway
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    17305 (Mfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    17305 (Mfng)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    17305 (Mfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    17305 (Mfng)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     17305 (Mfng)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   17305 (Mfng)
SSDB
Motif
Pfam: Fringe Galactosyl_T N_NLPC_P60
Other DBs
NCBI-GeneID: 17305
NCBI-ProteinID: NP_032621
MGI: 1095404
Ensembl: ENSMUSG00000018169
Vega: OTTMUSG00000021012
UniProt: O09008 Q3UPI0
Structure
PDB: 
2J0B 2J0A

Position
15 E1; 15 37.69 cM
AA seq 321 aa
MHCRLFRGMAGALFTLLCVGLLSLRYHSSLSQRMIQGALRLNQRNPGPLELQLGDIFIAV
KTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTNCSAEHSHPALS
CKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASE
LQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIE
CKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSR
FRSLHCLLYPDTPWCPLLAAP
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcactgccgactttttcggggcatggcgggagccctctttaccctcctgtgcgtgggg
ctcctgtctctacgataccactcaagtttgtcccagaggatgatacagggcgcgctcagg
ctgaaccaacggaacccaggacccctggagctgcagctaggcgacatcttcatcgcagtc
aagactacctgggccttccatcgctcccgcctggacctgctactagacacgtgggtctcc
aggatcaggcaacagacattcatcttcactgacagcccagatgaacgcctccaggagaga
ctaggcccgcacctcgtggtcaccaactgttctgcagagcacagtcatcctgctctgtcc
tgcaagatggctgcagagttcgatgccttcttggtcagtggcctcaggtggttctgccac
gtggatgatgacaactatgtgaaccccaaggctctgctgcagctgttgaaaacattcccg
caggaccgtgatgtctatgtgggcaagcccagcctgaaccggcccatccacgcctctgag
ctgcagtcaaaaaaccgcacgaagctggtgcggttctggtttgccacagggggtgctggt
ttctgcatcaaccgccaactggctttgaagatggtgccatgggccagcggctcccacttt
gtggacacttctgctctcatccggctccccgatgactgcactgtgggctacatcatcgag
tgcaagctggggggtcgcctgcagcccagccccctcttccactcacacctggaaaccctg
cagctgctgggggccgcccagcttccggagcaggtcaccctcagctacggtgtctttgag
gggaaactgaatgtcatcaagctaccgggccccttctcccatgaagaggacccctccaga
ttccgctccctccattgtctcctctacccagacacaccctggtgtccgctgctggcagcg
ccctga

KEGG   Mus musculus (mouse): 19719
Entry
19719             CDS       T01002                                 

Gene name
Rfng
Definition
(RefSeq) RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00514  Other types of O-glycan biosynthesis
mmu04330  Notch signaling pathway
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    19719 (Rfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    19719 (Rfng)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    19719 (Rfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    19719 (Rfng)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     19719 (Rfng)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   19719 (Rfng)
SSDB
Motif
Pfam: Fringe
Other DBs
NCBI-GeneID: 19719
NCBI-ProteinID: NP_033079
MGI: 894275
Ensembl: ENSMUSG00000025158
Vega: OTTMUSG00000004135
UniProt: O09009
Position
11 E2; 11 84.53 cM
AA seq 332 aa
MSRARRVLCRACLALAAVLAVLLLLPLPLPLPLPRAPAPDPDRVPTRSLTLEGDRLQPDD
VFIAVKTTRKNHGPRLRLLLRTWISRAPRQTFIFTDGDDPELQMLAGGRMINTNCSAVRT
RQALCCKMSVEYDKFLESGRKWFCHVDDDNYVNPKSLLHLLSTFSSNQDIYLGRPSLDHP
IEATERVQGGGTSNTVKFWFATGGAGFCLSRGLALKMSPWASLGSFMSTAERVRLPDDCT
VGYIVEGLLGARLLHSPLFHSHLENLQRLPSGAILQQVTLSYGGPENPHNVVNVAGSFNI
QQDPTRFQSVHCLLYPDTHWCPMKNRVEGAFQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagccgtgcgcggcgggtgttgtgccgggcctgcctcgcgctggccgcggtcctggct
gtgttgctgctactgccgctgccgctaccgctgccgctgcctcgcgcgcccgcaccggac
cccgatcgggtcccgacccggagcctgaccctcgagggagaccgcctgcaacccgacgac
gtcttcattgcagtcaagaccactcggaagaaccacggcccgcgcctgcggctgctgctg
cgtacctggatctcacgagccccacggcagacgttcattttcaccgatggagacgaccct
gagctccagatgctggcaggcggccgcatgatcaacaccaattgctctgctgtgcgcacc
cgccaagcactgtgctgcaaaatgtcggtggaatatgataagttcctagaatctggacga
aaatggttctgccacgtggatgatgacaactacgtgaaccccaaaagcctgctgcacctg
ctttccaccttctcttccaaccaggacatctacctggggcgacctagcctggaccacccc
atcgaagccacagagagggtccaaggcggtggcacctcaaacacagtgaaattctggttt
gctactggtggggctgggttctgcctgagcaggggccttgccctcaaaatgagcccgtgg
gccagccttggcagtttcatgagcacagcagagcgggttcggctgcctgatgactgcact
gtgggatacatcgtggaaggacttctgggcgcccgtctgctccatagccccctgttccac
tcgcacctggaaaacctgcagaggctgccgtctggtgctattttgcagcaggttaccttg
agctatgggggtcctgagaacccacataatgtggtgaatgtagctggcagtttcaacata
cagcaggaccctacacggtttcagtctgtgcactgccttctctacccagacacccactgg
tgtcctatgaagaacagggttgagggagctttccagtaa

DBGET integrated database retrieval system