KEGG   Mus musculus (house mouse): 16852
Entry
16852             CDS       T01002                                 
Symbol
Lgals1, Gal-1, Galbp, L-14.5, L14, Lect14, galectin-1
Name
(RefSeq) lectin, galactose binding, soluble 1
  KO
K06830  galectin-1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16852 (Lgals1)
   04091 Lectins [BR:mmu04091]
    16852 (Lgals1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   16852 (Lgals1)
Lectins [BR:mmu04091]
 S-type lectins (Galectins)
  16852 (Lgals1)
SSDB
Motif
Pfam: Gal-bind_lectin DUF1344
Other DBs
NCBI-GeneID: 16852
NCBI-ProteinID: NP_032521
MGI: 96777
Ensembl: ENSMUSG00000068220
UniProt: P16045
Position
15:78810925..78814665
AA seq 135 aa
MACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINY
MAADGDFKIKCVAFE
NT seq 408 nt   +upstreamnt  +downstreamnt
atggcctgtggtctggtcgccagcaacctgaatctcaaacctggggaatgtctcaaagtt
cggggagaggtggcctcggacgccaagagctttgtgctgaacctgggaaaagacagcaac
aacctgtgcctacacttcaatcctcgcttcaatgcccatggagacgccaacaccattgtg
tgtaacaccaaggaagatgggacctggggaaccgaacaccgggaacctgccttccccttc
cagcccgggagcatcacagaggtgtgcatcacctttgaccaggctgacctgaccatcaag
ctgccagacggacatgaattcaagttccccaaccgcctcaacatggaggccatcaactac
atggcggcggatggagacttcaagattaagtgcgtggcctttgagtga

DBGET integrated database retrieval system