KEGG   Mus musculus (mouse): 16857
Entry
16857             CDS       T01002                                 

Gene name
Lgals6, galect, galectin-6
Definition
(RefSeq) lectin, galactose binding, soluble 6
  KO
K10091  galectin-4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16857 (Lgals6)
Lectins [BR:mmu04091]
 S-type lectins (Galectins)
  16857 (Lgals6)
SSDB
Motif
Pfam: Gal-bind_lectin
Other DBs
NCBI-GeneID: 16857
NCBI-ProteinID: NP_034837
MGI: 107535
UniProt: O54891
Position
7 B1; 7
AA seq 301 aa
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSFYIQGTAKENMRRFHVNFAVGQDDGADV
AFHFNPRFDGWDKVVFNTKQSGRWGKEEEKSMPFQKGKHFELVFMVMPEHYKVVVNGSPF
YEYGHRLPVQMVTHLQVDGDLELQSINFFGVQPVETKYPAMTGPPVFNPCLPYVGALQGG
FTVRRTIIIKGYVLPTAKTFAINFRVGSSEDIALHINPRIGDCLVRNSYMNGSWGTEERM
VAYNPFGPGQFFDLSIRCGMDRFKVFANGIHLFNFSHRFQALRKINTLEINGDLTLSYVH
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcctatgttccagcaccgggctaccagcccacctacaatccgactctgccctacaag
agacccatcccaggtggcctcagtgtcgggatgtccttttacatccaaggaacggccaaa
gagaacatgagacggttccacgtgaacttcgctgtggggcaggatgatggggcggatgtt
gctttccacttcaatccccgctttgatggctgggacaaggtggtcttcaacacgaagcaa
agcggacgatggggcaaggaagaggagaagagcatgcctttccagaagggcaagcacttc
gagctggtgttcatggtcatgcctgagcactacaaggtcgtggtgaatggaagtcccttc
tatgaatacgggcaccggttacctgtacagatggtcacccatctgcaagtggatggggac
ctggaacttcagtccatcaacttcttcggagtccaacctgttgaaaccaaatatccggcc
atgacaggacccccagtcttcaatccgtgtctgccatatgtgggggctctgcaggggggc
tttacagtccgaagaaccatcataatcaagggatatgtacttcctacagccaagaccttt
gccatcaacttcagggtgggatcttccgaagacatagctttacacataaacccccgcata
ggtgactgtttggttcgcaacagctatatgaatggctcttggggcactgaagagaggatg
gtggcctacaacccatttggccctgggcagttctttgatctgtcaatccgctgcggcatg
gatcgattcaaggtgtttgccaatggcattcaccttttcaacttctcccatcggttccaa
gctttacgaaagataaacacgctggagatcaatggtgacctcaccttgtcctacgtccac
atctga

DBGET integrated database retrieval system