KEGG   Mus musculus (house mouse): 16858
Entry
16858             CDS       T01002                                 
Symbol
Lgals7, Galectin-7, Pig1
Name
(RefSeq) lectin, galactose binding, soluble 7
  KO
K10092  galectin-7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16858 (Lgals7)
Lectins [BR:mmu04091]
 S-type lectins (Galectins)
  16858 (Lgals7)
SSDB
Motif
Pfam: Gal-bind_lectin WIF
Other DBs
NCBI-GeneID: 16858
NCBI-ProteinID: NP_001389967
MGI: 1316742
Ensembl: ENSMUSG00000053522
Position
7:28563221..28565710
AA seq 136 aa
MSATQHKTSLPQGVRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEV
VFNTKEQGKWGREERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVR
LVEVGGDVQLHSVKIF
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtctgctacccagcacaagacctccctgcctcagggcgtccgcgtgggcactgtcatg
agaattcgaggcatggtccctgaccaggctggcaggttccatgtaaacctgctatgcggt
gaggagcaaggagcagatgccgccttgcactttaacccgaggctggacacttccgaggtt
gtcttcaacaccaaagaacaaggcaaatggggccgtgaggagcgaggcaccggcatcccc
ttcgagcgtgggcagccctttgaagtgctcctcatcgccacagaggaaggcttcaaggct
gtggtcggggatgacgaatatctccacttccaccaccggatgccgcccgcgcgcgtgcgc
ttggtggaggtgggcggagacgtgcagctgcattcagtgaagatcttctaa

DBGET integrated database retrieval system