KEGG   Mus musculus (mouse): 16865Help
Entry
16865             CDS       T01002                                 

Gene name
Eif2d, D1Ertd5e, Lgtn
Definition
(RefSeq) eukaryotic translation initiation factor 2D
  KO
K15027  translation initiation factor 2D
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    16865 (Eif2d)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-2D
    16865 (Eif2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pre-PUA SUI1 PUA T2SSM MbeD_MobD Kin17_mid
Motif
Other DBs
NCBI-GeneID: 16865
NCBI-ProteinID: NP_001129542
MGI: 109342
Ensembl: ENSMUSG00000026427
Vega: OTTMUSG00000021553
UniProt: Q61211
Position
1 E4; 1 56.9 cM
AA seq 570 aa AA seqDB search
MFAKAFRVKSNTAIKGSDRRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDS
VTVYTSGGNPILFELEKNLYPTVYTLWAYPDILPTFITWPLVLEKLVGGADLMLPGVVVP
PTGLPQVQQGDLCAIALVGNRAPVAIGVAAMSTAQMLASGLKGKGVSVLHTYQDHLWRSG
DKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQD
SLDGKPLQEQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCCPEGQQLDIKKSS
YKKLSKFLQHMQQEQIVQVKELSKGVESIVAVDWRHPRITSFVIPEPSLTSQTVQEVSRE
QPYLPPDIKSLYCVPANMTQLFLESGHKKGSTLEGSEVRKIITDYAKRNRLVDADNRNLV
KLDPILCDCILEKNEQHLVTKLPWDCLLTRCLKNMQPAYQVTFPGQEPILKKGKLCPIDI
TLALKTYNKKVTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQVQVQGNQI
HHLGQLLLEEYRLPGKYIQGLEKAPKPGKK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctaaggcctttcgggtcaagtccaacacagccatcaagggctcggacaggaga
aagctccgggccgatgtgacagctgctttccctgccctgggaacagatcagatctctgaa
ttgatacctggaaaggaagagctaaatgttgtgaagttgtatgttcacaaaggggattcg
gtgactgtgtacacgagtggtggtaaccccatcctatttgaactggagaaaaatttgtat
ccaacagtgtacacactgtgggcctatccggatattctaccaacttttataacatggcct
ctggtattggaaaaactggtcgggggagcagatttgatgctgccaggggtagtggtgccc
cctactggtcttcctcaagtacagcaaggcgacctctgtgccattgccttggtggggaac
agagcgcccgttgcaattggagtggccgccatgtccacagctcagatgctggcttcaggc
ctgaagggaaaaggtgtctctgtgctccacacttatcaggaccacttgtggagatctgga
gacaagtcctctccacctgccattgccccactggaccccacagatagctgcgaagagaag
gtgcaccttggtctgcagggaaacctgaagagcctgaccctggacggagaggaggagaac
gggcaggttcctctccgagaagcctctgaggacaccagctccagggccccgagccaggat
tccttggacggcaagccccttcaggaacaaatggacgatctgttactgcggtgcttcctt
catgccctgaagagtcgagtcaagaaagctgacctcccgttgctcaccagcactctcctt
ggcagtcacatgttctcctgctgtcctgaaggacagcaactggatataaagaagtcaagc
tataaaaagctctctaagttcctgcagcacatgcagcaggagcagattgtccaggtcaag
gagctgagcaaaggggtggagagcattgtggctgtggactggaggcacccgaggatcacg
tctttcgtcatccccgagccttccctgacttcccagactgtccaggaagttagcagggaa
cagccctatctccctccagatataaaatccctctactgtgtcccagccaacatgacccag
ctcttcctggagtctggccacaagaaggggagcacccttgagggcagtgaggtccgaaag
atcatcacggactatgccaagagaaacagactggtggatgcagacaacagaaatctggtg
aagttggatcctatcttatgtgactgcatcttagagaaaaatgagcagcacttggtcacg
aagctcccatgggactgtctcctgaccaggtgtttgaaaaatatgcagcctgcctaccaa
gtaacatttcctggccaggaacccattctaaagaaagggaaactctgtccaattgatatc
acccttgcactgaagacctataataaaaaggtgactgtggtccggaacttggagacctat
ggtctagatccgtgctcagtggccgccattctccagcagcgatgtcaggcaagcaccatc
gtctctcctgcccctggggccaaagacagtctgcaggtgcaggtccagggaaaccagatc
caccaccttggccagctactgcttgaagagtatcggctccctggaaaatacatccaaggc
ctagaaaaggcccccaaacctggcaagaagtga

DBGET integrated database retrieval system