KEGG   Mus musculus (house mouse): 16865
Entry
16865             CDS       T01002                                 
Symbol
Eif2d, D1Ertd5e, Lgtn
Name
(RefSeq) eukaryotic translation initiation factor 2D
  KO
K15027  translation initiation factor 2D
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    16865 (Eif2d)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-2D
    16865 (Eif2d)
SSDB
Motif
Pfam: Pre-PUA SUI1 PUA RNA_pol_Rpb1_6 T2SSM Kin17_mid MbeD_MobD
Other DBs
NCBI-GeneID: 16865
NCBI-ProteinID: NP_001129542
MGI: 109342
Ensembl: ENSMUSG00000026427
UniProt: Q61211
Position
1:131080903..131115396
AA seq 570 aa
MFAKAFRVKSNTAIKGSDRRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDS
VTVYTSGGNPILFELEKNLYPTVYTLWAYPDILPTFITWPLVLEKLVGGADLMLPGVVVP
PTGLPQVQQGDLCAIALVGNRAPVAIGVAAMSTAQMLASGLKGKGVSVLHTYQDHLWRSG
DKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQD
SLDGKPLQEQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCCPEGQQLDIKKSS
YKKLSKFLQHMQQEQIVQVKELSKGVESIVAVDWRHPRITSFVIPEPSLTSQTVQEVSRE
QPYLPPDIKSLYCVPANMTQLFLESGHKKGSTLEGSEVRKIITDYAKRNRLVDADNRNLV
KLDPILCDCILEKNEQHLVTKLPWDCLLTRCLKNMQPAYQVTFPGQEPILKKGKLCPIDI
TLALKTYNKKVTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQVQVQGNQI
HHLGQLLLEEYRLPGKYIQGLEKAPKPGKK
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgttcgctaaggcctttcgggtcaagtccaacacagccatcaagggctcggacaggaga
aagctccgggccgatgtgacagctgctttccctgccctgggaacagatcagatctctgaa
ttgatacctggaaaggaagagctaaatgttgtgaagttgtatgttcacaaaggggattcg
gtgactgtgtacacgagtggtggtaaccccatcctatttgaactggagaaaaatttgtat
ccaacagtgtacacactgtgggcctatccggatattctaccaacttttataacatggcct
ctggtattggaaaaactggtcgggggagcagatttgatgctgccaggggtagtggtgccc
cctactggtcttcctcaagtacagcaaggcgacctctgtgccattgccttggtggggaac
agagcgcccgttgcaattggagtggccgccatgtccacagctcagatgctggcttcaggc
ctgaagggaaaaggtgtctctgtgctccacacttatcaggaccacttgtggagatctgga
gacaagtcctctccacctgccattgccccactggaccccacagatagctgcgaagagaag
gtgcaccttggtctgcagggaaacctgaagagcctgaccctggacggagaggaggagaac
gggcaggttcctctccgagaagcctctgaggacaccagctccagggccccgagccaggat
tccttggacggcaagccccttcaggaacaaatggacgatctgttactgcggtgcttcctt
catgccctgaagagtcgagtcaagaaagctgacctcccgttgctcaccagcactctcctt
ggcagtcacatgttctcctgctgtcctgaaggacagcaactggatataaagaagtcaagc
tataaaaagctctctaagttcctgcagcacatgcagcaggagcagattgtccaggtcaag
gagctgagcaaaggggtggagagcattgtggctgtggactggaggcacccgaggatcacg
tctttcgtcatccccgagccttccctgacttcccagactgtccaggaagttagcagggaa
cagccctatctccctccagatataaaatccctctactgtgtcccagccaacatgacccag
ctcttcctggagtctggccacaagaaggggagcacccttgagggcagtgaggtccgaaag
atcatcacggactatgccaagagaaacagactggtggatgcagacaacagaaatctggtg
aagttggatcctatcttatgtgactgcatcttagagaaaaatgagcagcacttggtcacg
aagctcccatgggactgtctcctgaccaggtgtttgaaaaatatgcagcctgcctaccaa
gtaacatttcctggccaggaacccattctaaagaaagggaaactctgtccaattgatatc
acccttgcactgaagacctataataaaaaggtgactgtggtccggaacttggagacctat
ggtctagatccgtgctcagtggccgccattctccagcagcgatgtcaggcaagcaccatc
gtctctcctgcccctggggccaaagacagtctgcaggtgcaggtccagggaaaccagatc
caccaccttggccagctactgcttgaagagtatcggctccctggaaaatacatccaaggc
ctagaaaaggcccccaaacctggcaagaagtga

DBGET integrated database retrieval system