KEGG   Mus musculus (mouse): 16871Help
Entry
16871             CDS       T01002                                 

Gene name
Lhx3, Lim3, P-LIM, mLIM3, mLim-3
Definition
(RefSeq) LIM homeobox protein 3
  KO
K09374  LIM homeobox protein 3/4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16871 (Lhx3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    16871 (Lhx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN DUF3480 Furin-like_2
Motif
Other DBs
NCBI-GeneID: 16871
NCBI-ProteinID: NP_034841
MGI: 102673
Ensembl: ENSMUSG00000026934
Vega: OTTMUSG00000012728
UniProt: P50481
Structure
PDB: 

Position
2 A3; 2 18.44 cM
AA seq 400 aa AA seqDB search
MLLEAELDCHRERPGAPGASALCTFSRTPEIPMCAGCDQHILDRFILKALDRHWHSKCLK
CSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFA
CVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYN
TSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGS
SKSDKDSIQEGQDSDAEVSFTDEPSMADMGPANGLYSSLGEPAPALGRPVGGLGSFTLDH
GGLTGPEQYRELRPGSPYGIPPSPAAPQSLPGPQPLLSSLVYPDTNLSLVPSGPPGGPPP
MRVLAGNGPSSDLSTESSSGYPDFPASPASWLDEVDHAQF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagaagcagaactcgattgccaccgagagaggcccggtgcccctggagcttct
gccctctgtaccttcagcaggactccagagatcccgatgtgtgcaggctgtgaccagcac
atcttggaccgtttcatccttaaggctctggaccgacattggcacagcaagtgtctcaag
tgcagtgactgccacgtccctctggctgagcgctgcttcagccgcggggagagcgtctac
tgcaaagacgacttctttaagcgcttcgggaccaagtgcgccgcatgccagctgggcatc
ccgcccacgcaggtggtgcgccgcgcccaggacttcgtgtaccacctgcattgcttcgcc
tgcgtggtctgcaagcggcagctggccacgggcgacgagttctacctcatggaagacagc
cggctggtgtgcaaggcggactacgaaacagccaagcagcgagaagccgaggccacagcc
aagcggccgcgcaccaccatcaccgccaagcagctggagacgctgaagagcgcctacaac
acttcgcccaagccggcgcgccacgtgcgcgagcagctctcctccgagaccggcctggac
atgcgagtggtgcaggtgtggttccagaatcgccgggctaaggaaaagagactgaagaaa
gacgctggccggcagcgctggggacagtatttccgcaatatgaagcgctcccgcggcagt
tccaagtccgacaaggacagcatccaggagggacaagacagcgacgccgaagtctccttc
actgatgagccgtccatggctgacatggggcctgctaatggcctgtacagcagcctggga
gagcctgcccctgcgttgggccggcccgtaggaggcctgggcagctttaccctggatcac
ggaggcttgacgggtccagagcagtaccgagagctacgcccaggcagcccctatggcatc
cccccatctcctgcagccccccagagccttcctggcccccagcctctcctctccagcctg
gtatacccagacaccaacttgagccttgtcccttcagggcccccaggtggacccccaccc
atgagggtgctggctggaaatgggcccagctccgacctgtccacagagagcagttctggc
tacccagactttcctgctagccctgcttcctggctggatgaagtagaccatgctcagttc
tga

DBGET integrated database retrieval system