KEGG   Mus musculus (house mouse): 16882
Entry
16882             CDS       T01002                                 
Symbol
Lig3, D11Wsu78e
Name
(RefSeq) ligase III, DNA, ATP-dependent
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    16882 (Lig3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    16882 (Lig3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     16882 (Lig3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     16882 (Lig3)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 16882
NCBI-ProteinID: NP_001278174
MGI: 109152
Ensembl: ENSMUSG00000020697
UniProt: Q80ZH7
Position
11:82671935..82695100
AA seq 1012 aa
MTLAFKILFPRNLCALGRKELCLFPEQNRWAAISQFSQWSETNLLGGCCLLQRRKPVLAL
QRGHLRPRATHLTFWPGSHVGLCTGPCAMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQ
HIADLSSKAAATPKKKAAVQAKLTTTGQVTSPVKGASFITSTNPRKFSGFSAAKPNNSEQ
APSSPAPGTSLSASKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIHDFLQKGSTGDG
FHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRIFF
EQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKH
DLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNEQEVEKDPGRRRALRVQASLM
TPVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKV
AHFKDYIPKAFPGGQSMILDSEVLLIDNNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCI
YFNDVSLMDRPLCERRKFLHDNMVEIRNRIMFSEMKQVTKASDLADMINRVIREGLEGLV
LKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDP
DSQKWCTVTKCAGGHDDATLARLQKELVMVKISKDPSKIPSWLKINKIYYPDFIVPDPKK
AAVWEITGAEFSRSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKDKADF
AVVAGDEASPTTGGSSGENEGTAGSAGPCKGPPSKSSASAKTTEQKLNSPSSRGGIKPIP
KHSPMKPGEKLAVKSSPVKVGMKRKATDETPCLKKVLLDVFTGVRLYLPPSTPDFKRLKR
YFVAFDGDLVQEFDMGSATHVLGNREKNTDAQLVSSEWIWACIRKRRLIAPC
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgactttggctttcaagatcctcttcccgagaaacctttgtgcccttggcagaaaagaa
ctgtgcctgttcccagaacagaatcgctgggctgccataagtcagttcagccagtggtcg
gaaacaaatctcctcggtgggtgctgccttctccagagaagaaagcctgtcctagctctc
cagagaggtcatctaagaccacgtgccacccaccttactttctggccagggtcgcatgtg
ggactctgtactggcccctgtgcgatggcagagcagcggttctgtgtggactatgccaag
cggggcacagctggatgcaagaaatgcaaggagaagattgtaaagggcgtgtgccgcatt
ggcaaagtggtgcccaaccccttctcagagtctgggggtgatatgaaagagtggtaccac
attaagtgcatgtttgagaaactggaacgggctcgggccaccacaaagaaaattgaagac
ctcacagagctggaaggctgggaagagctggaagataacgaaaaggaacagataagccag
catattgcagacctgtcttctaaggcagctgccacacctaagaagaaagctgctgtccag
gctaagctgacaaccactggccaggtgacatctccagtgaaaggtgcttcgtttattacc
agtaccaatcctcggaagttctctggcttttcagcagcaaaacccaacaactctgagcaa
gccccctcaagccctgctcctggaacgagtctgtctgcaagtaaatgtgaccctaagcac
aaagattgtctgctacgagagttccggaagctgtgcgccatggtggctgaaaatcctagc
tataacaccaagacccagatcatccatgacttcttgcagaaaggctccacaggagatggc
tttcacggtgatgtgtacctgacagttaagctgctgctgcctggtgtcatcaagagtgtt
tacaacttgaatgataagcagattgtaaaactttttagccgaatttttaactgcaaccca
gatgatatggcccgggacctagaacagggtgacgtgtcagagacgatcagaatcttcttt
gagcagagcaagtctttccccccagctgccaaaagcctcctcaccattcaggaagtggat
gccttcctcctgcacctctccaagctcaccaaagaggatgagcagcagcaggccctgcag
gacatagcctcccggtgtacagccaatgaccttaagtgcattattcggctgatcaaacat
gatctgaagatgaactcgggtgcaaaacacgtgttagatgcccttgaccccaatgcttat
gaagccttcaaagcatcgcgcaacctgcaggatgtggtggagcgagtccttcacaatgag
caggaggtggagaaggacccaggccggcgacgggctctgagggtccaggcctcactgatg
acgcctgtgcagcccatgctggctgaggcctgcaaatccattgaatatgcaatgaagaag
tgtcccaatggcatgttctctgagatcaagtacgatggtgagcgagtccaggtgcataag
aagggggaccacttcagctacttcagccgcagtctcaagcctgtcctgcctcacaaggtg
gcccacttcaaggactatatacccaaagcttttcctgggggtcaaagcatgatcttggat
tccgaggtactcctgattgacaacaacacaggcaaaccactgccctttgggactctggga
gtgcacaagaaagctgctttccaggatgctaatgtctgcctgtttgtttttgattgtatc
tactttaatgatgtcagcttgatggacaggcctctctgtgagcgacggaagtttcttcat
gacaacatggttgaaatccgtaaccggatcatgttctcagaaatgaagcaagtcacaaaa
gcttcagacctggctgacatgataaaccgggtgatccgagagggcttggaagggttggtg
ctaaaggatgtgaagggtacatatgagcctgggaagcggcactggctgaaagttaagaaa
gattatttgaatgagggggccatggctgatacagctgatctggtggttcttggggccttc
tatgggcaagggagcaaaggcggaatgatgtccatcttcctcatgggctgctatgaccct
gacagccaaaagtggtgcactgttacaaaatgtgctggaggccatgatgatgccacactt
gcccgcctgcagaaagagctggttatggtgaagatcagcaaggatcctagtaagataccc
agctggctgaagatcaacaagatctattatcctgactttatcgtcccagacccaaagaaa
gctgctgtgtgggagatcacaggggcagaattctccagatctgaggcacacactgctgat
ggcatctccatccgatttcctcgatgcacccgaatccgggacgacaaggactggaaatct
gccactaacctcccccaactcaaggaactgtaccagctgtccaaagacaaggcagacttt
gctgtggtggctggagatgaggcaagccccactactggaggcagcagtggcgagaacgag
ggcactgctgggtctgctgggccctgcaagggcccccccagtaagtcctctgccagtgcc
aagaccaccgaacagaagctcaatagccccagtagcagaggtggcatcaaaccgattcca
aagcattcccccatgaaaccaggagagaagctggctgtgaagtcttctccagtcaaagtg
ggaatgaagaggaaagctactgatgagaccccatgcctgaaaaaggtactgttggatgtc
ttcactggggtgcggctctacttgccaccttctacaccagacttcaaacgtctcaaacgc
tactttgtggcattcgacggggacctggtacaggaatttgacatgggctcagccacacat
gtgctaggtaacagggaaaagaacactgatgcccagttggtctcctcagagtggatttgg
gcatgtatccggaaacggaggctgatagctccctgctag

DBGET integrated database retrieval system