KEGG   Mus musculus (mouse): 16890Help
Entry
16890             CDS       T01002                                 

Gene name
Lipe, 4933403G17Rik, HSL
Definition
(RefSeq) lipase, hormone sensitive
  KO
K07188  hormone-sensitive lipase [EC:3.1.1.79]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04152  AMPK signaling pathway
mmu04371  Apelin signaling pathway
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    16890 (Lipe)
   04024 cAMP signaling pathway
    16890 (Lipe)
   04152 AMPK signaling pathway
    16890 (Lipe)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    16890 (Lipe)
   04923 Regulation of lipolysis in adipocyte
    16890 (Lipe)
   04925 Aldosterone synthesis and secretion
    16890 (Lipe)
  Environmental adaptation
   04714 Thermogenesis
    16890 (Lipe)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     16890 (Lipe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSL_N Abhydrolase_3 Say1_Mug180 PRP4
Motif
Other DBs
NCBI-GeneID: 16890
NCBI-ProteinID: NP_001034596
MGI: 96790
Ensembl: ENSMUSG00000003123
Vega: OTTMUSG00000034139
UniProt: P54310
Position
7 A3; 7 13.78 cM
AA seq 759 aa AA seqDB search
MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHH
FDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQ
LRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPF
LQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKA
FWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPV
LARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPRSRALVVHIHGGGFVAQTSKS
HEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAYCWAVKHCDLLGSTGERICLA
GDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSK
CVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPQKT
TSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMET
LGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRSSQGVLHMPLY
TSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDSVMFARRLRDLGQPVTLKVVE
DLPHGFLSLAALCRETRQATEFCVQRIRLILTPPAAPLN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgcacgatgacacagtcgctggtgacactcgcagaagacaatatggccttc
ttctcaagccagggcccaggagagacagcacggcggctgtctaatgtctttgcaggtgtt
cgggaacaggcactggggctggaaccaaccctaggccaactgttgggtgtggcacaccat
tttgacctggacacagagacaccagccaacggataccgtagtttggtgcacacagcccga
tgctgcctggcacacctactacacaaatcccgctatgtggcttctaaccgcaaaagtatc
ttcttccgtgccagccacaacctagcagagctggaggcctacctggccgccctcacccag
ctccgtgctatggcctactatgcccagcgcctgctgaccatcaaccgaccaggagtgctc
ttcttcgagggtgatgaaggactcaccgctgacttcctgcaagagtatgtcacgctacac
aaaggctgcttctacggccgctgcctgggcttccagttcacacctgccatccggccgttc
ctgcagactctctccatcgggctggtgtccttcggggagcactacaaacgcaacgagaca
ggcctcagtgtgaccgccagttccctctttaccggtggccgattcgccatagacccagag
ttgcgtggggctgaatttgaacgcatcatacagaacctggatgtgcacttctggaaagcc
ttctggaacatcactgagattgaggtgctgtcgtctctggccaacatggcatcaaccact
gtgagggtaagccgcctgctcagcttgccacctgaggcctttgagatgccactcacctct
gatcccaggctcacagttaccatctcacctcccttggcacacacgggaccagctcctgtg
ctagccaggctcatctcctatgacctacgggaaggacaggacagcaaggtactcaacagc
ctggcaaaatctgagggcccacgcctggagctgcgcccacggcctcaccaagcaccccgt
tcacgggccctggttgttcacatccacggaggcggctttgtggcacagacctctaaatcc
cacgagccctacctcaagaactgggcccaggagctaggagtccctatcttctccatcgac
tactccctggcccccgaggctccctttccccgagcgctggaggagtgtttttttgcctac
tgctgggctgtcaagcactgtgacctgcttggttcaactggagagcggatatgccttgca
ggggacagtgcaggtgggaatctctgcatcactgtgtcccttcgggcagcagcctatgga
gtgagggtgccagatggcatcatggcagcctacccagttaccaccctgcagtcctctgct
tctccctctcgtctgctgagcctcatggaccctcttctaccactgagcgtactctctaag
tgtgtcagtgcctattcagggacagaggcagaggaccattttgactcagaccagaaggca
ctaggcgtgatggggctggtgcagagagacacttcgctgttcctcagagacctccgactg
ggtgcctcctcatggctcaactccttcctggaactaagtggacgcaagccccaaaagacc
acatcgcccacagcagagtctgtgcgccccacggagtctatgcgcaggagtgtgtctgag
gcagccctggcccagcctgagggcttactgggcacagataccttgaagaagctgacaata
aaggacttgagcaactcagagccttcagacagccccgagatgtcacagtcaatggagaca
cttggcccctccacaccctctgatgtcaacttttttctgcggcctgggaattcccaggaa
gaggctgaagccaaagatgaagtgagacccatggacggagtcccccgcgtgcgcgctgct
ttccctgaggggtttcacccccggcgctcaagccaaggtgtcctccacatgcccctctac
acgtcacccatagtcaagaaccccttcatgtctcctctgctggcccctgacagcatgctg
aagaccttgccgcctgtgcaccttgtggcttgcgctctggaccccatgctagatgactcg
gtcatgttcgcgcggcgactgcgcgacctgggccagccggtgacgctgaaagtggtagaa
gatctgccgcatggcttcctgagcctggcggcactgtgtcgcgagacccggcaggccacg
gagttctgcgtgcagcgcatccggctgatcctcaccccgcctgctgcaccactgaactga

DBGET integrated database retrieval system