KEGG   Mus musculus (house mouse): 16897
Entry
16897             CDS       T01002                                 
Symbol
Llgl1, Lgl1, Llglh, Mgl1
Name
(RefSeq) LLGL1 scribble cell polarity complex component
  KO
K06094  lethal(2) giant larvae protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    16897 (Llgl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    16897 (Llgl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16897 (Llgl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16897 (Llgl1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    16897 (Llgl1)
SSDB
Motif
Pfam: LLGL Lgl_C WD40
Other DBs
NCBI-GeneID: 16897
NCBI-ProteinID: NP_001152876
MGI: 102682
Ensembl: ENSMUSG00000020536
UniProt: Q80Y17
Position
11:60590501..60605012
AA seq 1036 aa
MMKFRFRRQGADPQREKLKQELFAFHKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKI
YGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWEIIHHNGCAHLEEGLSFH
PPSRPSFDNASFPASLTRVTVVLLVAGNTAALGTESGSIFFLDVATLALLEGQTLSPDVV
LRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVIWSQATQSVDNVFLGNQQLE
SLCWGRDGSSIISSHSDGSYAIWSTDTGSPPTLQPTVVTTPYGPFPCKAINKILWRSCES
GDHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRVIDFFTVHSTQPEDECDNPQAL
AVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSP
QPASSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQT
DCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQMVVAGTAGQVLVL
ELSEVPAEHAVSVANVDLLQDREGFTWKGHERLNPHTGLLPWPAGFQPRMLIQCLPPAAV
TAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSLR
QSFRRIRKSRVSGKKRTPAASSKLQEANAQLAEQTCPHDLEMTPVQRRIEPRSADDSLSG
VVRCLYFADTFLRDATHHGPTMWAGTNSGSVFAYALEVPAATAGGEKRPEQAVEAVLGKE
VQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKV
SAKTKFKLTAHEGCRVRKVALATFASVMSEDYAETCLACLTNLGDVHVFSVPGLRPQVHY
SCIRKEDISGIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDISWPQNATQPR
LQESPKLSQANGTRDIILAPESCEGSPSSAHSKRADTMEPPEAALSPVSIDSAASGDTML
DTTGDVTVEYVKDFLG
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgatgaagtttcggttccggcggcagggcgccgacccgcagcgcgagaagcttaagcag
gagctcttcgccttccacaagactgtggagcatggcttccccaatcagcccagcgccttg
gccttcgatcctgagctccgcatcatggccatcggcaccagatctggggccgtcaagatc
tatggtgcacccggagtggaatttacaggcctacatcgggacgcagccaccgtcacccag
atgcatttcctccctggtcagggccgcctcctgaccctgctagatgacagcagcttgcat
ctctgggagatcatccatcataatggctgcgcccacctggaggaaggcctcagcttccac
ccacccagcagacccagttttgacaatgccagtttccctgccagtctaacacgtgtcact
gtggtcctgctcgtagctggcaatacagcagccctgggaactgagagtggtagcatattc
ttcctggatgtagccaccctggcactgctggaggggcagactctcagcccagatgtggtt
ctgcgcagtgtgccagatgattaccggtgtggaaaggccttgggccctgtggagtcactc
cagggacatctgcaagaccccagcaagatcctcataggctacagtcggggtttactggtc
atctggagccaggccacacagtctgtggacaacgttttcctaggtaaccagcagctggag
agcctgtgttggggccgtgatggcagcagcattatcagctcacacagtgatggcagctat
gccatctggtccacagacactggcagccccccaacgctgcagcccactgtagtgaccaca
ccctacggccccttcccctgcaaggccatcaacaagattctgtggcggagctgtgagtca
ggagaccactttatcatcttcagtggtggcatgcctcgagccagctatggtgaccgccac
tgtgtgagtgtactgcgagcagagacactggtgaccctggacttcacctctcgtgtcatt
gacttcttcacggtgcacagcacacagccagaggatgagtgtgacaacccccaggcctta
gccgtgcttctggaggaggagctggtggtgctggacctgcagacaccaggctggccagct
gtgcccgccccttacctggccccactgcattcgtcagctatcacctgctctgcccatgtt
gccaatgtccccagcaagctgtgggcccgcattgtaagtgctggtgagcagcagagccca
cagcctgcctccagtgccttgagttggcccattaccgggggccggaacttggcccaggaa
ccctcgcagcgtgggctgctgctcactggccatgaggatggcactgtgcggttctgggac
gcctctggtgtggcgctaaggccactctacaaactgagcacagctggcctcttccagacg
gactgtgaacatgctgacagcctggcccaggctgtggaggatgactggccgcccttccgc
aaggtgggctgctttgatccctacagtgatgacccccggctaggaatccagaaggttgcg
ctttgcaagtacacagcccagatggtggtagctggcactgcaggccaggtgctggtgctg
gagctcagtgaggtcccagcagagcatgccgtcagtgtggccaacgtggatcttcttcag
gatcgcgagggcttcacgtggaagggtcacgagcggctgaacccacacacggggctgctg
ccgtggcctgccggattccagccccgcatgctgatacagtgcctcccacccgccgctgtc
actgctgtcacactccatgctgagtggagcctcgtggcctttggtaccagtcatggcttt
ggcctttttgactaccagcgcaagagccctgtgctggctaggtgcacccttcaccccaat
gattctttggccatggaggggccactgtcacgggtgaagtccctcaagaagtcactgaga
cagtcattccggcgaatccgcaagagccgtgtctcaggcaaaaaacggactcctgctgcc
agtagcaagttgcaggaggccaatgcccagctggccgagcagacctgcccacacgacctg
gagatgacacccgtgcagcgccgcattgagcctcggtctgctgacgactcgctctccggt
gttgtacgctgcctctactttgctgacacgttccttcgagatgcgacccaccacgggccc
accatgtgggcgggcaccaactcgggctctgtgttcgcctatgcgctggaggttccagca
gccacagcaggcggagagaagcggcctgagcaggcagtggaggcggtgctgggcaaggag
gtgcagctaatgcaccgagcacctgtggtggccattgctgtgctggatggtcgtggccgg
ccactgcctgagccctatgaggcttcccgggacctggcccaggcgccagacatgcaaggc
ggccatgctgtgctcattgcatctgaggaacaattcaaggtgttcacactacccaaggtg
agtgctaagactaaattcaagcttacagcccatgaaggctgtcgtgtgcggaaggtagcc
ctggctacatttgccagcgtgatgtctgaggactatgccgagacctgccttgcctgcctc
accaacctgggtgatgtccacgtcttctcggtgcctggcctgaggcctcaggtgcactac
tcctgtatccggaaggaggacatcagtggcatcgcttcctgtgtcttcacacgtcacggc
cagggcttttacttgatttctccatcggaatttgagcgcttctcactgagtgctcgcaac
atcacagaaccactatgttctctggatataagctggccccaaaatgccacccagcccagg
cttcaagagtcacccaagctgagccaggctaatgggaccagagacatcattctggcccca
gagagctgcgaaggaagccctagctctgcccacagcaagcgagctgataccatggaacca
cccgaggccgctctctcgcctgtgtccattgattcagctgctagtggggataccatgctg
gacacaacaggggatgtcaccgtggaatatgtgaaggattttctggggtga

DBGET integrated database retrieval system