KEGG   Mus musculus (mouse): 16911Help
Entry
16911             CDS       T01002                                 

Gene name
Lmo4, A730077C12Rik, Crp3, Etohi4
Definition
(RefSeq) LIM domain only 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LIM DUF678 Arc_trans_TRASH
Motif
Other DBs
NCBI-GeneID: 16911
NCBI-ProteinID: NP_001155241
MGI: 109360
Ensembl: ENSMUSG00000028266
Vega: OTTMUSG00000029080
UniProt: P61969 Q542S1
Structure
PDB: 

Position
3 H2; 3 68.61 cM
AA seq 165 aa AA seqDB search
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDI
GTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRN
RLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatccgggcagcagctcgcagccgcccccggtgacggccggctccctctcctgg
aagcgctgcgcaggctgcgggggcaagatcgcggaccgctttctgctctatgccatggac
agctactggcatagccgctgcctcaagtgctcctgctgccaggcgcagctgggcgacatt
ggcacgtcctgttacaccaagagcggcatgatcctttgcagaaatgactacattaggtta
tttgggaatagcggtgcttgcagtgcctgtggacagtcgattcctgcaagtgagctcgtc
atgagggcccaaggcaacgtgtatcatctcaagtgtttcacatgttctacctgccggaat
cgcctggtcccgggagatcggtttcactacatcaatggcagtttattttgtgaacatgat
agacccacagccctcatcaatggccatttgaattcacttcagagcaatccactactgcca
gaccagaaggtctgctga

DBGET integrated database retrieval system