KEGG   Mus musculus (mouse): 16918
Entry
16918             CDS       T01002                                 

Gene name
Mycl, AW536278, L-my, L-myc, Lmyc, Lmyc-, Lmyc-1, Lmyc1, Mycl1, bHLHe3, bHLHe38
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene lung carcinoma derived
  KO
K09110  L-myc proto-oncogene protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16918 (Mycl)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    16918 (Mycl)
SSDB
Motif
Pfam: Myc_N HLH DUF3287
Other DBs
NCBI-GeneID: 16918
NCBI-ProteinID: NP_032532
MGI: 96799
Ensembl: ENSMUSG00000028654
Vega: OTTMUSG00000008931
UniProt: P10166 Q3UIE0
Position
4 D2.2; 4 57.36 cM
AA seq 368 aa
MDFDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGSGPGAVDPASGINP
GEPWPGGGAGDEAESRGHSKAWGRNYASIIRRDCMWSGFSARERLERVVSDRLAPGAPRG
NPPKAPATPDGTPSLEASNPAPATQCQLGEPKTQACSGSESPSDSEGEEIDVVTVEKRRS
LDIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEGDPEPGPQEEAPEI
EAPKEKEEEEEEEEEEEIVSPPPVGSEAPQSCHPKPVSSDTEDVTKRKNHNFLERKRRND
LRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKKMATEKRQLRCRQQQLQK
RIAYLSGY
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggacttcgactcgtatcagcactatttctacgactatgactgcggagaggatttctac
cgctccacggcgcccagcgaggacatctggaagaaattcgagctggtgccgtcgcccccc
acgtcgccgccctggggctccggtcccggcgccgtggacccagcctctgggattaatccc
ggggagccgtggcctggagggggtgccggggacgaggcggaatctcggggccattcgaaa
gcctggggcaggaattatgcttccatcattcgccgtgactgcatgtggagcggcttctcc
gcccgagaacggctggagagagtggtgagcgacaggctggccccaggcgcgccccggggg
aacccgcccaaagcgcccgctaccccggacggcactcctagtctggaagccagtaacccg
gcgcccgccacccaatgtcagctgggcgagcccaagactcaggcctgctccgggtccgag
agccccagcgattctgaaggtgaagagattgacgtggtgaccgtggagaagaggcgatct
ctggacatccgaaagccagtcaccatcacggtgcgagcagaccccctggacccctgcatg
aagcacttccatatctctatccaccaacagcagcataactatgctgcccgttttcctcca
gaaagttgctctcaagagggggatcctgagccaggtccccaggaagaggctccggagata
gaagctcccaaggagaaagaggaggaggaagaggaagaggaggaagaagagattgtgagc
cccccacctgtcggaagtgaggctccccagtcctgccaccccaaacctgtcagttctgac
actgaggacgtgaccaagaggaagaaccataacttcttggaacgaaaaaggaggaatgac
ctccgctcccggttcctagccctgcgggaccaggttcccaccctggccagctgctctaag
gcccccaaagtcgtgatcctcagcaaggcgttagaatacttgcaggctttggtgggggct
gaaaagaaaatggctacagagaaaaggcagctccggtgtcggcaacagcaactgcaaaag
agaatcgcgtacctcagtggctactaa

DBGET integrated database retrieval system