KEGG   Mus musculus (mouse): 16922Help
Entry
16922             CDS       T01002                                 

Gene name
Phyh, AI256161, AI265699, Lnap1, PAHX
Definition
(RefSeq) phytanoyl-CoA hydroxylase
  KO
K00477  phytanoyl-CoA hydroxylase [EC:1.14.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    16922 (Phyh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.18  phytanoyl-CoA dioxygenase
     16922 (Phyh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhyH
Motif
Other DBs
NCBI-GeneID: 16922
NCBI-ProteinID: NP_034856
MGI: 891978
Ensembl: ENSMUSG00000026664
Vega: OTTMUSG00000010818
UniProt: O35386 Q3TPC7
Position
2; 2 A1
AA seq 338 aa AA seqDB search
MNLTRAGARLQVLLGHLGRPSAPTIVAQPVSGLASPASFQPEQFQYTLDNNVLTLEQRKF
YEENGFLVIKNLVSDDDIQRFRAEFERICREEVKPPGIVIMRDVALAKQDYMPSDRMVSK
IQDFQEDEELFRYCLLPEILKYVECFTGPNIMALHGMLINKPPDVGKKTSRHPLHQDLHY
FPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYPKWEGGVNKMYHGIQDYD
PNSPRVHLVMEKGDTVFFHPLLIHGSGRNKTQGFRKAISCHFGSSDCQCIDVSGTSQENI
AREVVEMAEKKYGFQGVMDFKDTWIFRSRLVKGERINI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttacgcgcgccggcgcccggctgcaggtccttctgggacacctcggccgaccc
tcggccccaacgattgtagcccagcctgtatcagggttggcttcccctgccagtttccag
cctgaacaattccagtatactctggataataatgtcctcaccctggagcagagaaaattt
tatgaagaaaatgggtttctcgtcattaagaatctggtatctgatgatgacattcaacgt
tttcgagcagagtttgaaagaatctgcagagaggaggtgaaaccaccagggatcgttata
atgagagatgtggcccttgcaaaacaggattatatgccaagtgataggatggtttcaaag
atccaggatttccaagaagatgaggagctcttcagatactgccttctccccgagattctg
aagtatgtggagtgtttcactggacccaatattatggctctgcatgggatgctgatcaac
aagcctccagatgttggcaagaagacatcccggcatcccttgcatcaggatctgcactat
ttccccttccgacctagcaacctaattgtttgtgcttggacagccatggagcacattgac
agaaacaacggttgtctggttgtgctcccaggtacccacaaaggcactctgaagccacat
gattaccccaagtgggagggaggtgttaacaaaatgtaccatggcatccaagactatgac
cccaacagcccccgggtccacctagtgatggaaaagggcgatactgttttcttccaccct
ctgctcatccatggatctggtcggaacaaaactcaaggcttccggaaagcaatttcctgc
cacttcggcagctctgactgccagtgtatcgatgtgagcggcaccagtcaagaaaatatt
gcaagggaagttgtcgagatggcagagaaaaagtatggattccaaggagtcatggacttt
aaggacacttggatatttcgaagccgacttgtgaaaggagaaagaataaacatttga

DBGET integrated database retrieval system