KEGG   Mus musculus (mouse): 16956
Entry
16956             CDS       T01002                                 

Gene name
Lpl
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu03320  PPAR signaling pathway
mmu04979  Cholesterol metabolism
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    16956 (Lpl)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    16956 (Lpl)
  09154 Digestive system
   04979 Cholesterol metabolism
    16956 (Lpl)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16956 (Lpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16956 (Lpl)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16956 (Lpl)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    16956 (Lpl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     16956 (Lpl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   16956 (Lpl)
  Exosomal proteins of breast milk
   16956 (Lpl)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Enzymes
   16956 (Lpl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  16956 (Lpl)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_1 Abhydrolase_6
Other DBs
NCBI-GeneID: 16956
NCBI-ProteinID: NP_032535
MGI: 96820
Ensembl: ENSMUSG00000015568
Vega: OTTMUSG00000036084
UniProt: P11152
Position
8 B3.3; 8 33.88 cM
AA seq 474 aa
MESKALLLVVLGVWLQSLTAFRGGVAAADAGRDFSDIESKFALRTPEDTAEDTCHLIPGL
ADSVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH
YPVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTEDGKQHNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMMKLKWISDSYFSWPDW
WSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKGKDSAVFVKCHDKSLKKSG
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggtcctgggagtttggctccagagtttgaccgcc
ttccgaggaggggtggccgcagcagacgcgggaagagatttctcagacatcgaaagcaaa
tttgccctaaggacccctgaagacacagctgaggacacttgtcatctcattcctggatta
gcagactctgtgtctaactgccacttcaaccacagcagcaagaccttcgtggtgatccat
ggatggacggtaacgggaatgtatgagagttgggtgcccaaacttgtggccgccctgtac
aagagagaacctgactccaatgtcattgtagtagactggttgtatcgggcccagcaacat
tatccagtgtcagctggctacaccaagctggtgggaaatgatgtggccagattcatcaac
tggatggaggaggagtttaactaccccctagacaacgtccacctcttagggtacagcctt
ggagcccatgctgctggcgtagcaggaagtctgaccaataagaaggtcaatagaattact
ggtttggatccagctgggcctaactttgagtatgcagaagcccccagtcgcctttctcct
gatgacgctgattttgtagatgtcttacacacatttaccagggggtcacctggtcgaagt
attggaatccagaaaccagtagggcatgttgacatttatcccaatggaggcactttccag
ccaggatgcaacattggagaagccatccgtgtgattgcagagagaggactcggagacgtg
gaccagctggtgaagtgctcgcacgagcgctccattcatctcttcattgactccctgctg
aatgaagaaaaccccagcaaggcatacaggtgcaactccaaggaagcctttgagaaaggg
ctctgcctgagttgtagaaagaatcgctgtaacaatctgggctatgagatcaacaaggtc
agagccaagagaagcagcaagatgtacctgaagactcgctctcagatgccctacaaagtg
ttccattaccaagtcaagattcacttttctgggactgaggatggcaagcaacacaaccag
gccttcgagatttctctgtacggcacagtggccgagagcgagaacattcccttcaccctg
cccgaggtttccacaaataaaacctactccttcttgatttacacggaggtggacatcgga
gaactgctcatgatgaagcttaagtggataagcgactcctacttcagctggcctgactgg
tggagcagccccagcttcgtcatcgagaggatccgagtgaaagccggagagactcagaaa
aaggtcatcttctgtgctagggagaaagtttctcatctgcagaagggaaaggactcagca
gtgtttgtgaaatgccatgacaagtctctgaagaagtctggctga

DBGET integrated database retrieval system