KEGG   Mus musculus (house mouse): 16969
Entry
16969             CDS       T01002                                 
Symbol
Zbtb7a, 9030619K07Rik, 9130006G12Rik, AI452336, FBI-1, Lrf, Pokemon, Zbtb7
Name
(RefSeq) zinc finger and BTB domain containing 7a
  KO
K10494  zinc finger and BTB domain-containing protein 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16969 (Zbtb7a)
   04121 Ubiquitin system [BR:mmu04121]
    16969 (Zbtb7a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    16969 (Zbtb7a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     16969 (Zbtb7a)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 DUF3268 zf-met
Other DBs
NCBI-GeneID: 16969
NCBI-ProteinID: NP_034861
MGI: 1335091
Ensembl: ENSMUSG00000035011
UniProt: O88939
Position
10:80970416..80988056
AA seq 569 aa
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEFFRSNPMNSLPPTAFPWS
GFGAPDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPADRPPAGDGDEGDSTPGLWPE
RDEDAPPGGLFPPPTAPPATTQNGHYGRAGAGTGEEEAAALSEAAPEPGDSPGFLSGAAE
GEDGDAADVDGLAASTLLQQMMSSVGRAGDSDEESRTDDKGVMDYYLKYFSGAHEGDVYP
AWSQKGEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLK
VHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLK
KDGCNGVPSRRGRKPRVRGVPPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDG
SGRLNVAGSGGDDGAGGPAVATAEGNFAT
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggctggcggcgtggacggccccatcgggatcccgttcccggaccacagcagcgacatc
ctgagcggcctgaacgagcagcggactcaggggctgctttgcgacgtggtgattcttgtg
gaaggacgtgagttccccacgcaccgctcggtgctggccgcctgcagccagtacttcaag
aagctgttcacgtcgggagctgtagtggaccagcagaacgtgtacgagatcgacttcgtg
agtgccgaggcactgacggcgctcatggacttcgcctacaccgccacgctcacggtcagc
acggccaatgtgggcgacatcctgagtgcagcacggctgctggagatcccggccgtgagc
cacgtgtgcgccgacctgctggagcgtcagattctggcggctgatgatgtgggcgacgcg
agccagcccgacggggcgggccccactgaccagcgcaacctgctgcgtgccaaggagtac
ctggagttcttccgcagtaaccccatgaatagcctgccccccactgccttcccatggtct
ggcttcggtgcccccgacgacgacctggacgccaccaaggaggctgtggccgccgctgtg
gccgctgtggccgcaggcgactgcaatggcttggacttctatggcccagggcccccggct
gatcggcccccagccggcgatggagatgagggtgacagtaccccagggctgtggcctgag
agagatgaagatgccccgcccggagggctcttcccacctcctactgccccaccggccacc
acacagaacggccactatggccgtgcaggggctggcaccggtgaagaagaagcggcggct
ctctctgaggccgctccagagccgggcgactccccgggcttcctgtcaggcgctgcagag
ggcgaggatggggacgccgctgatgtggatgggctagcggccagcacgctgctacagcag
atgatgtcatcggtgggccgggccggggacagtgatgaggagtcgcgaaccgacgacaag
ggcgtcatggactactacctgaagtacttcagtggagcccacgagggggatgtgtaccca
gcctggtcacagaagggtgagaagaaaatccgggccaaggccttccagaagtgtcccatc
tgcgagaaggtgattcagggtgccggcaagctgccccgtcacatccgcacgcacacgggc
gagaagccctacgagtgtaacatctgtaaagttcgattcaccagacaggacaagctgaag
gtgcacatgcggaagcacacgggtgagaagccgtacctgtgccagcagtgcggcgccgcc
ttcgcgcacaactacgacctgaagaaccacatgcgggtgcacacggggctgcggccatac
cagtgcgatagctgctgcaagacctttgtgcgctccgaccatctgcacagacacctcaag
aaggacggctgcaatggggtcccctcgcgccgcggccgcaagccccgtgtgcggggtgtg
ccacccgatgtccctgccggggccggcgcaccccccgggctcccggacgccccgcgcaat
ggccaggagaagcactttaaggacgaggaggaggacgaggaggaggccagcccggacggc
tcaggccgcctgaatgtagcgggcagcggaggagacgatggtgcaggtggcccggcggtg
gccaccgccgagggtaacttcgcaacctga

DBGET integrated database retrieval system