KEGG   Mus musculus (mouse): 16971Help
Entry
16971             CDS       T01002                                 

Gene name
Lrp1, A2mr, AI316852, CD91, Lrp, b2b1554Clo
Definition
(RefSeq) low density lipoprotein receptor-related protein 1
  KO
K04550  low-density lipoprotein receptor-related protein 1 (alpha-2-macroglobulin receptor)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04979  Cholesterol metabolism
mmu05010  Alzheimer disease
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    16971 (Lrp1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16971 (Lrp1)
  09174 Infectious disease: parasitic
   05144 Malaria
    16971 (Lrp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16971 (Lrp1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16971 (Lrp1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    16971 (Lrp1)
CD molecules [BR:mmu04090]
 Proteins
  16971 (Lrp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 SGL cEGF EGF_CA EGF TadE
Motif
Other DBs
NCBI-GeneID: 16971
NCBI-ProteinID: NP_032538
MGI: 96828
Ensembl: ENSMUSG00000040249
Vega: OTTMUSG00000031813
UniProt: Q91ZX7 A0A0R4J0I9 Q3U454
Position
10; 10 D3
AA seq 4545 aa AA seqDB search
MLTPPLLLLLPLLSALVSGATMDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDE
APEICPQSKAQRCPPNEHSCLGTELCVPMSRLCNGIQDCMDGSDEGAHCRELRANCSRMG
CQHHCVPTPSGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGY
LLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYAN
ETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDD
IDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRT
KLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVF
ENYLYATNSDNANTQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACE
NDQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIR
GMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKD
GIHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLN
GWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAF
YDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVAGAPPTV
TLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDTDG
VTCLANPSYVPPPQCQPGEFACANNRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDR
FKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDD
DCGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQ
FKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHSDEFQCRLDGLCIPLR
WRCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEEN
CEALACRPPSHPCANNTSVCLPPDKLCDGKDDCGDGSDEGELCDQCSLNNGGCSHNCSVA
PGEGIVCSCPLGMELGSDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGE
SCRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVED
KIYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRT
TLLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGL
TVDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTN
TLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNR
TVSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTV
LDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDT
NKKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNHTLLFS
GQKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSELEVIDTMRSQLGKATALAIMGDKL
WWADQVSEKMGTCNKADGSGSVVLRNSTTLVMHMKVYDESIQLEHEGTNPCSVNNGDCSQ
LCLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVS
GTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNI
YWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGHYPRIERSRLD
GTERVVLVNVSISWPNGISVDYQGGKLYWCDARMDKIERIDLETGENREVVLSSNNMDMF
SVSVFEDFIYWSDRTHANGSIKRGCKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVC
AVANGGCQQLCLYRGGGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERN
LNAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIV
ENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVL
DECQNLMFWTNWNELHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLD
KIERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVD
IPQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRA
VNSSCRAQDEFECANGECISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCV
SNMLWCNGVDDCGDGSDEIPCNKTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNC
STTDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLN
YFACPSGRCIPMSWTCDKEDDCENGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDC
GDGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCTDGADESVTAGCLYNSTCD
DREFMCQNRLCIPKHFVCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECD
GENDCHDHSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGC
HVNECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADLDECSTTFPCSQLCINT
HGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNA
VALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWC
DKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSG
RSIIVDTKITWPNGLTVDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTL
FEDYVYWTDWETKSINRAHKTTGANKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNG
GCSNLCLLSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDC
GDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFK
CTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDC
VDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPY
QFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHD
CADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEF
QCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFICPPNRPFRCKNDRVCLWIGRQCDGV
DNCGDGTDEEDCEPPTAQNPHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSID
PKLTSCATNASMCGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCN
NTKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQTFQGDES
VRIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKM
PRGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSD
WGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDP
IVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLY
HQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGT
CTLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEYCHNGGTCAASPSGMPTCRCP
TGFTGPKCTAQVCAGYCSNNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGFCENFGTCQ
MAADGSRQCRCTVYFEGPRCEVNKCSRCLQGACVVNKQTGDVTCNCTDGRVAPSCLTCID
HCSNGGSCTMNSKMMPECQCPPHMTGPRCEEQVVSQQQPGHMASILIPLLLLLLLLLVAG
VVFWYKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKP
TNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
NT seq 13638 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccccgccgttgctgctgctgctgccgctgctttcagctctggtctccggggcc
actatggatgcccctaaaacttgcagccctaagcagtttgcctgcagagaccaaatcacc
tgtatctcaaagggctggcggtgtgacggtgaaagagattgccccgacggctctgatgaa
gcccctgagatctgtccacagagtaaagcccagagatgcccgccaaatgagcacagttgt
ctggggactgagctatgtgtccccatgtctcgtctctgcaacgggatccaggactgcatg
gatggctcagacgagggtgctcactgccgagagctccgagccaactgttctcgaatgggt
tgtcaacaccattgtgtacctacacccagtgggcccacgtgctactgtaacagcagcttc
cagctgcaggcagatggcaagacgtgcaaagattttgacgagtgttccgtgtatggcacc
tgcagccagctttgcaccaacacagatggctccttcacatgtggctgtgttgaaggctac
ctgctgcaaccggacaaccgctcctgcaaggccaagaatgagccagtagatcggccgcca
gtgctactgattgccaactctcagaacatcctagctacgtacctgagtggggcccaagtg
tctaccatcacacccaccagcacccgacaaaccacggccatggacttcagttatgccaat
gagaccgtatgctgggtgcacgttggggacagtgctgcccagacacagctcaagtgtgcc
cggatgcctggcctgaagggctttgtggatgagcataccatcaacatctccctcagcctg
caccacgtggagcagatggcaatcgactggctgacgggaaacttctactttgtcgacgac
attgacgacaggatctttgtctgtaaccgaaacggggacacctgtgtcactctgctggac
ctggaactctacaaccccaaaggcatcgccttggaccccgccatggggaaggtgttcttc
actgactacgggcagatcccaaaggtggagcgctgtgacatggatggacagaaccgcacc
aagctggtggatagcaagatcgtgtttccacacggcatcaccctggacctggtcagccgc
ctcgtctactgggcggacgcctacctagactacatcgaggtggtagactacgaagggaag
ggtcggcagaccatcatccaaggcatcctgatcgagcacctgtacggcctgaccgtgttt
gagaactatctctacgccaccaactcggacaatgccaacacgcagcagaagacgagcgtg
atccgagtgaaccggttcaacagtactgagtaccaggtcgtcacccgtgtggacaagggt
ggtgccctgcatatctaccaccagcgacgccagccccgagtgcggagtcacgcctgtgag
aatgaccagtacgggaagccaggtggctgctccgacatctgcctcctggccaacagtcac
aaggcaaggacctgcaggtgcaggtctggcttcagcctgggaagtgatgggaagtcttgt
aagaaacctgaacatgagctgttcctcgtgtatggcaagggccgaccaggcatcattaga
ggcatggacatgggggccaaggtcccagatgagcacatgatccccatcgagaaccttatg
aatccacgcgctctggacttccacgccgagaccggcttcatctactttgctgacaccacc
agctacctcattggccgccagaaaattgatggcacggagagagagactatcctgaaggat
ggcatccacaatgtggagggcgtagccgtggactggatgggagacaatctttactggact
gatgatggccccaagaagaccattagtgtggccaggctggagaaagccgctcagacccgg
aagactctaattgagggcaagatgacacaccccagggccattgtagtggatccactcaat
gggtggatgtactggacagactgggaggaggaccccaaggacagtcggcgagggcggctc
gagagggcttggatggacggctcacaccgagatatctttgtcacctccaagacagtgctt
tggcccaatgggctaagcctggatatcccagccggacgcctctactgggtggatgccttc
tatgaccgaattgagaccatactgctcaatggcacagaccggaagattgtatatgagggt
cctgaactgaatcatgccttcggcctgtgtcaccatggcaactacctcttttggaccgag
taccggagcggcagcgtctaccgcttggaacggggcgtggcaggcgcaccgcccactgtg
acccttctgcgcagcgagagaccgcctatctttgagatccgaatgtacgacgcgcagcag
cagcaagtgggtaccaacaaatgccgggtaaataacggaggctgcagcagcctgtgcctc
gccacccccgggagccgccagtgtgcctgtgccgaggaccaggtgttggacacagatggt
gtcacctgcttggcgaacccatcctacgtgcccccaccccagtgccagccgggcgagttt
gcctgtgccaacaaccgctgcatccaggagcgctggaagtgtgacggagacaacgactgt
ctggacaacagcgatgaggccccagcactgtgccatcaacacacctgtccctcggaccga
ttcaagtgtgagaacaaccggtgtatccccaaccgctggctctgtgatggggataatgat
tgtggcaacagcgaggacgaatccaatgccacgtgctcagcccgcacctgtccacccaac
cagttctcctgtgccagtggccgatgcattcctatctcatggacctgtgatctggatgat
gactgtggggaccggtccgatgagtcagcctcatgcgcctaccccacctgcttccccctg
actcaatttacctgcaacaatggcagatgtattaacatcaactggcggtgtgacaacgac
aatgactgtggggacaacagcgacgaagccggctgcagtcactcctgctccagtacccag
ttcaagtgcaacagtggcagatgcatccccgagcactggacgtgtgatggggacaatgat
tgtggggactacagcgacgagacacacgccaactgtaccaaccaggctacaagacctcct
ggtggctgccactcggatgagttccagtgccgcctagatggcctgtgcatccccctgagg
tggcgctgcgacggggacaccgactgcatggattccagcgatgagaagagctgtgagggc
gtgacccatgtttgtgacccgaatgtcaagtttggctgcaaggactccgcccggtgcatc
agcaaggcgtgggtgtgtgatggcgacagcgactgtgaagataactccgacgaggagaac
tgtgaggccctggcctgcaggccaccctcccatccctgcgccaacaacacctctgtctgc
ctgcctcctgacaagctgtgcgacggcaaggatgactgtggagacggctcggatgagggc
gagctctgtgaccagtgttctctgaataatggtggctgtagtcacaactgctcagtggcc
cctggtgaaggcatcgtgtgctcttgccctctgggcatggagctgggctctgacaaccac
acctgccagatccagagctactgtgccaagcacctcaaatgcagccagaagtgtgaccag
aacaagttcagtgtgaagtgctcctgctacgagggctgggtcttggagcctgacggggaa
agctgccgcagtctggatcccttcaaaccgttcatcatcttctccaaccgccacgagatc
aggcgcattgaccttcacaagggggactacagcgtcctagtgcctggcctgcgcaacact
attgccctggacttccacctcagccagagtgccctctactggaccgacgtggtagaggac
aagatctaccgtgggaaactcctggacaacggagccctgaccagctttgaggtggtgatt
cagtatggcttggccacaccagagggcctggctgtagattggattgcaggcaacatctac
tgggtggagagcaacctggaccagatcgaagtggccaagctggacggaaccctccgaacc
actctgctggcgggtgacattgagcacccgagggccatcgctctggaccctcgggatggg
attctgttttggacagactgggatgccagcctgccacgaatcgaggctgcgtccatgagt
ggggctggccgccgaaccatccaccgggagacaggctctgggggctggcccaacgggctc
accgtggattacctggagaagcgcatcctctggattgatgctaggtcagatgccatctat
tcagcccggtatgacggctccggccacatggaggtgcttcggggacacgagttcctgtca
cacccatttgccgtgacactgtacggtggggaggtgtactggaccgactggcgaacaaat
acactggctaaggccaacaagtggactggccacaacgtcaccgtggtacagaggaccaac
acccagcccttcgacctgcaggtgtatcacccttcccggcagcccatggctccaaaccca
tgtgaggccaatggcggccggggcccctgttcccatctgtgcctcatcaactacaaccgg
accgtctcctgcgcctgtccccacctcatgaagctgcacaaggacaacaccacctgctat
gagtttaagaagttcctgctgtacgcacgtcagatggagatccggggcgtggacctggat
gccccgtactacaattatatcatctccttcacggtgcctgatatcgacaatgtcacggtg
ctggactatgatgcccgagagcagcgagtttactggtctgatgtgcggactcaagccatc
aaaagggcatttatcaacggcactggcgtggagaccgttgtctctgcagacttgcccaac
gcccacgggctggctgtggactgggtctcccgaaatctgttttggacaagttacgacacc
aacaagaagcagattaacgtggcccggctggacggctccttcaagaatgcggtggtgcag
ggcctggagcagccccacggcctggtcgtccacccgcttcgtggcaagctctactggact
gatggggacaacatcagcatggccaacatggatgggagcaaccacactctgctcttcagt
ggccagaagggccctgtggggttggccattgacttccctgagagcaaactctactggatc
agctctgggaaccacacaatcaaccgttgcaatctggatgggagcgagctggaggtcatc
gacaccatgcggagccagctgggcaaggccactgccctggccatcatgggggacaagctg
tggtgggcagatcaggtgtcagagaagatgggcacgtgcaacaaagccgatggctctggg
tccgtggtgctgcggaacagtaccacgttggttatgcacatgaaggtgtatgacgagagc
atccagctagagcatgagggcaccaacccctgcagtgtcaacaacggagactgttcccag
ctctgcctgccaacatcagagacgactcgctcctgtatgtgtacagccggttacagcctc
cggagcggacagcaggcctgtgagggtgtgggctcttttctcctgtactctgtacatgag
ggaattcgggggattccactagatcccaatgacaagtcggatgccctggtcccagtgtcc
ggaacttcactggctgtcggaatcgacttccatgccgaaaatgacactatttattgggtg
gatatgggcctaagcaccatcagcagggccaagcgtgaccagacatggcgagaggatgtg
gtgaccaacggtattggccgtgtggagggcatcgcggtggactggatcgcaggcaacata
tactggacggaccagggcttcgatgtcatcgaggttgcccggctcaatggctcttttcgt
tatgtggtcatttcccagggtctggacaagcctcgggccatcactgtccacccagagaag
gggtacttgttctggaccgagtggggtcattacccacgtattgagcggtctcgccttgat
ggcacagagagagtggtgttggttaatgtcagcatcagctggcccaatggcatctcagta
gactatcagggcggcaagctctactggtgtgatgctcggatggacaagatcgagcgcatc
gacctggaaacgggcgagaaccgggaggtggtcctgtccagcaataacatggatatgttc
tccgtgtccgtgtttgaggacttcatctactggagtgacagaactcacgccaatggctcc
atcaagcgcggctgcaaagacaatgctacagactccgtgcctctgaggacaggcattggt
gttcagcttaaagacatcaaggtcttcaacagggacaggcagaagggtaccaatgtgtgc
gcggtagccaacggcgggtgccagcagctctgcttgtatcggggtggcggacagcgagcc
tgtgcctgtgcccacgggatgctggcagaagacggggcctcatgccgagagtacgctggc
tacctgctctactcagagcggaccatcctcaagagcatccacctgtcggatgagcgtaac
ctcaacgcaccggtgcagccctttgaagaccccgagcacatgaaaaatgtcatcgccctg
gcctttgactaccgagcaggcacctccccggggacccctaaccgcatcttcttcagtgac
atccactttgggaacatccagcagatcaatgacgatggctcgggcaggaccaccatcgtg
gaaaatgtgggctctgtggaaggcctggcctatcaccgtggctgggacacactgtactgg
acaagctacaccacatccaccatcacccgccacaccgtggaccagactcgcccaggggcc
ttcgagagggagacagtcatcaccatgtccggagacgaccacccgagagcctttgtgctg
gatgagtgccagaacctgatgttctggaccaattggaacgagctccatccaagcatcatg
cgggcagccctatccggagccaacgtcctgaccctcattgagaaggacatccgcacgccc
aatgggttggccatcgaccaccgggcggagaagctgtacttctcggatgccaccttggac
aagatcgagcgctgcgagtacgacggctcccaccgctatgtgatcctaaagtcggagccc
gtccacccctttgggttggcggtgtacggagagcacattttctggactgactgggtgcgg
cgggctgtgcagcgagccaacaagtatgtgggcagcgacatgaagctgcttcgggtggac
attccccagcaacccatgggcatcatcgccgtggccaacgacaccaacagctgtgaactc
tccccctgccgtatcaacaatggaggctgccaggatctgtgtctgctcacccaccaaggc
cacgtcaactgttcctgtcgagggggccggatcctccaggaggacttcacctgccgggct
gtgaactcctcttgtcgggcacaagatgagtttgagtgtgccaatggggaatgtatcagc
ttcagcctcacctgtgatggcgtctcccactgcaaggacaagtccgatgagaagccctcc
tactgcaactcacgccgctgcaagaagactttccgccagtgtaacaatggtcgctgtgta
tccaacatgctgtggtgcaatggggtggatgactgtggggatggctctgatgagattcct
tgcaacaagactgcctgtggtgtgggtgagttccgctgccgggatgggtcctgcatcggg
aactccagtcgctgcaaccagtttgtggattgtgaggatgcctcggatgagatgaattgc
agtaccacagactgcagcagctatttccgcctgggcgtgaaaggtgtcctcttccagccg
tgcgagcggacatccctgtgctacgcacctagctgggtgtgtgatggcgccaacgactgt
ggagactacagcgatgaacgtgactgtccaggtgtgaagcgccctaggtgcccgctcaat
tactttgcctgccccagcgggcgctgtatccccatgagctggacgtgtgacaaggaggat
gactgtgagaacggcgaggacgagacccactgcaacaagttctgctcagaggcacagttc
gagtgccagaaccaccggtgtatctccaagcagtggctgtgtgacggtagcgatgattgc
ggggatggctccgatgaggcagctcactgtgaaggcaagacatgtggcccctcctccttc
tcctgtcccggcacccacgtgtgtgtccctgagcgctggctctgtgatggcgacaaggac
tgtaccgatggcgcggatgagagtgtcactgctggctgcctgtacaacagcacctgtgat
gaccgtgagttcatgtgccagaaccgcttgtgtattcccaagcatttcgtgtgcgaccat
gaccgtgactgtgctgatggctctgatgaatcccctgagtgtgagtacccaacctgcggc
cccaatgaattccgctgtgccaatgggcgttgtctgagctcccgtcagtgggaatgtgat
ggggagaatgactgtcacgaccacagcgatgaggctcccaagaacccacactgcaccagc
ccagagcacaaatgcaatgcctcatcacagttcctgtgcagcagcgggcgctgcgtggct
gaggcgttgctctgcaacggccaggacgactgtggggacggttcagacgaacgcgggtgc
catgtcaacgagtgtctcagccgcaagctcagtggctgcagtcaggactgcgaggacctc
aagataggctttaagtgccgctgtcgcccgggcttccggctaaaggacgatggcaggacc
tgtgccgacctggatgagtgcagcaccaccttcccctgcagccagctctgcatcaacacc
cacggaagttacaagtgtctgtgtgtggagggctatgcaccccgtggcggtgacccccac
agctgcaaagctgtgaccgatgaggagccatttctcatctttgccaaccggtactacctg
cggaagctcaacctggacggctccaactacacactgcttaagcagggcctgaacaatgcg
gtcgccttggactttgactaccgagagcagatgatctactggacggacgtgaccacccag
ggcagcatgattcgcaggatgcacctcaacggcagcaacgtgcaggttctgcaccggacg
ggccttagtaacccagatgggctggctgtggactgggtgggtggcaacctgtactggtgt
gacaagggcagagataccattgaggtgtccaagcttaacggggcctatcggacagtgctg
gtcagctctggcctccgggagcccagagctctggtagtggatgtacagaatgggtacctg
tactggacagactggggtgaccactcactgatcggccggattggcatggatggatctggc
cgcagcatcatcgtggacactaagatcacatggcccaatggcctgaccgtggactacgtc
acggaacgcatctactgggctgacgcccgtgaggactacatcgagttcgccagcctggat
ggctccaaccgtcacgttgtgctgagccaagacatcccacacatctttgcgctgacccta
tttgaagactacgtctactggacagactgggaaacgaagtccatcaaccgggcccacaag
accacgggtgccaacaaaacactcctcatcagcaccctgcaccggcccatggacttacat
gtattccacgccctgcgccagccagatgtgcccaatcacccctgcaaagtcaacaatggt
ggctgcagcaacctgtgcctgctgtcccctgggggtggtcataaatgcgcctgccccacc
aacttctatctgggtggcgatggccgtacctgtgtgtccaactgcacagcaagccagttt
gtgtgcaaaaatgacaagtgcatccccttctggtggaagtgtgacacggaggacgactgt
ggggatcactcagacgagcctccagactgtcccgagttcaagtgccgcccaggccagttc
cagtgctccaccggcatctgcaccaaccctgccttcatctgtgatggggacaatgactgc
caagacaatagtgatgaggccaattgcgacattcacgtctgcttgcccagccaattcaag
tgcaccaacaccaaccgctgcattcctggcatcttccgttgcaatgggcaggacaactgc
ggggacggcgaggatgagcgggattgccctgaggtgacctgcgcccccaaccagttccag
tgctccatcaccaagcgctgcatccctcgcgtctgggtctgtgacagggataatgactgt
gtggacggcagtgatgagcctgccaactgtacccaaatgacctgtggagtggatgagttc
cgctgcaaggattctggccgctgcatccccgcgcgctggaagtgtgacggagaagatgac
tgtggggatggttcagatgagcccaaggaagagtgtgatgagcgcacctgtgagccatac
cagttccgctgcaaaaacaaccgctgtgtcccaggccgttggcaatgtgactacgacaac
gactgcggagataactcggacgaggagagctgcacacctcggccctgctctgagagtgag
ttttcctgtgccaatggccgctgcatcgctgggcgctggaagtgtgatggggaccatgac
tgtgccgacggctcagacgagaaagactgcaccccccgctgtgatatggaccagttccag
tgcaagagtggccactgcatccccctgcgctggcgctgtgacgcggatgctgactgtatg
gacggcagtgacgaggaagcctgtggcactggggtgaggacctgcccattggatgagttt
caatgtaacaacaccttgtgcaagccgctggcctggaagtgtgatggagaggacgactgt
ggggacaactcagatgagaaccccgaggaatgcgcccggttcatctgccctcccaaccgg
cctttccgctgcaagaatgaccgagtctgcctgtggattgggcgccagtgtgatggcgtg
gacaactgtggagatgggactgacgaggaggactgtgagccccccacggcccagaacccc
cactgcaaagacaagaaggagttcctgtgccgaaaccagcgctgtctatcatcctccctg
cgctgtaacatgttcgatgactgcggcgatggctccgatgaagaagattgcagcatcgac
cccaagctgaccagctgtgccaccaatgccagcatgtgtggggacgaagctcgttgtgtg
cgcactgagaaagctgcctactgtgcctgccgctcgggcttccatactgtgccgggccag
cccggatgccaggacatcaacgagtgcctgcgctttggtacctgctctcagctctgcaac
aacaccaagggaggccacctctgcagctgtgcccgcaacttcatgaagacacacaacacc
tgcaaagctgaaggctccgagtaccaggtgctatacatcgcggatgacaacgagatccgc
agcttgttcccgggccacccccactcagcctacgagcagacattccagggcgatgagagt
gtccgcatagatgccatggatgtccatgtcaaggccggccgtgtctactggactaactgg
cacacgggcacaatctcctacaggagcctgccccctgccgcccctcctaccacttccaac
cgccaccggaggcagatcgaccggggtgtcacccacctcaatatttcagggctgaagatg
ccgaggggtatcgctatcgactgggtggccgggaatgtgtactggaccgattccggccga
gacgtgattgaggtggcgcaaatgaagggcgagaaccgcaagacgctcatctcgggcatg
attgatgagccccatgccatcgtggtggaccctctgaggggcaccatgtactggtcagac
tgggggaaccaccccaagattgaaacagcagcgatggatggcacccttcgggagactctc
gtgcaagacaacattcagtggcctacagggctggctgtggactatcacaatgaacggctc
tactgggcagatgccaagctttcggtcatcggcagcatccggctcaacggcactgacccc
attgtggctgctgacagcaaacgaggcctaagtcaccccttcagcatcgatgtgtttgaa
gactacatctacggagtcacttacatcaataatcgtgtcttcaagatccacaagtttgga
cacagccccttgatcaacctaactgggggcctgagccatgcctctgatgtagtcctttac
catcaacacaagcagcctgaagtgaccaacccctgtgaccgcaagaaatgtgaatggctg
tgtctgctgagccccagcgggcctgtctgcacctgtcccaatggaaagaggctggataat
ggcacctgtgtgcctgtgccctctccaacaccccctccagatgcccctaggcctggaacc
tgcactctgcagtgcttcaatggtggtagttgtttcctcaatgctcggaggcagcccaag
tgccgttgccagccccgttacacaggcgataagtgtgagctggatcagtgctgggaatac
tgtcacaacggaggcacctgtgcggcttccccatctggcatgcccacgtgccgctgtccc
actggcttcacgggccccaaatgcaccgcacaggtgtgtgcaggctactgctctaacaac
agcacctgcaccgtcaaccagggcaaccagccccagtgccgatgtctacctggcttcctg
ggcgaccgttgccagtaccggcagtgctctggcttctgtgagaactttggcacctgtcag
atggctgctgatggctcccgacaatgtcgctgcaccgtctactttgagggaccaaggtgt
gaggtgaacaagtgtagtcgctgtctccaaggcgcctgtgtggtcaataagcagaccgga
gatgtcacatgcaactgcactgatggccgggtagcccccagttgtctgacctgcatcgat
cactgtagcaatggtggctcctgcaccatgaacagcaagatgatgcctgagtgccagtgc
ccgccccatatgacaggaccccggtgcgaggagcaggttgttagtcagcaacagcctggg
catatggcctccatcctgatccctctgctgctgcttctcctgctgcttctggtggctggc
gtggtgttctggtataagcggcgagtccgaggggctaagggcttccagcaccagcggatg
accaatggggccatgaatgtggaaattggaaaccctacctacaagatgtatgaaggtgga
gagcccgatgatgtcgggggcctactggatgctgattttgcccttgaccctgacaagcct
accaacttcaccaacccagtgtatgccacgctctacatggggggccacggcagccgccat
tccctggccagcacggacgagaagcgagaactgctgggccggggacctgaagacgagata
ggagatcccttggcatag

DBGET integrated database retrieval system