KEGG   Mus musculus (house mouse): 16980
Entry
16980             CDS       T01002                                 
Symbol
Lrrn2, 5730406J09Rik, NLRR-2
Name
(RefSeq) leucine rich repeat protein 2, neuronal
  KO
K24492  leucine-rich repeat neuronal protein 1/2/3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    16980 (Lrrn2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   16980 (Lrrn2)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set LRR_9 Ig_3 LRR_1 ig Ig_2 LRRNT V-set LRRCT fn3
Other DBs
NCBI-GeneID: 16980
NCBI-ProteinID: NP_034862
MGI: 106037
Ensembl: ENSMUSG00000026443
UniProt: Q6PHP6
Position
1:132808093..132867743
AA seq 730 aa
MRLLVAALLLSWVAGTTAAAPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFL
TAVPPRLPAGTQTLLLQSNSISRIDQTELAYLANLTELDLSQNSFSDARDCDFQALPQLL
SLHLEENRLNRLEDHSFAGLTSLQELYLNHNQLCRISPRAFAGLGNLLRLHLNSNLLRTI
DSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMSLREISDYALEGLQSLE
SLSFYDNQLAQVPKRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
IDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPN
LQEVGLHGNPIRCDCVIRWANATGTHVRFIEPQSTLCAEPPDLQRRPVREVPFREMTDHC
LPLISPRSFPSSLQIASGESTVLHCRALAEPEPEIYWVTPAGVRLTPARSGRRYRVFPEG
TLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGHAPFQPGRDKGPGLKLHVQETHPYH
ILLFWAPPPNIVSTNLTWSSASSLRDHEAPALARLPRGTHRYNITRLLPATEYWACLQVA
FADAHTQLACVWARTKEASPCHRALGDRPGLIAILALAVLLLAAGLAAHLGRGQSKQGVV
GEKPLLPVWAFWGWSAPSVRVVSAPLVLPWNPGRKQPRCQMGRGCHHHCLNIAEVPPGLS
SREITRTTLH
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgaggctcctcgtggctgccctcttgctatcttgggtggctggtaccaccgctgcagca
ccggtggtaccctggcgtgtgccctgccctcctcagtgtgcctgccagatccggccctgg
tacacaccccgctcgtcctaccgtgaagccaccactgtcgactgcaatgacctcttcctg
acggcagtgcccccaaggctccctgcggggacacagaccctgctcctgcagagtaacagc
atcagccggatagaccagactgagcttgcctacttggccaacctcacagagctggacctg
tcccagaacagcttctcagatgcccgagactgcgatttccaagccctgcctcagctgctg
agcctacatctagaagagaaccggctgaaccggctggaggatcacagcttcgctgggctg
accagcctgcaggagctctatctcaaccataaccagctctgccgcatctcccccagggcc
tttgcagggctgggtaacctgctgagactgcacctcaattccaacctgcttaggaccatc
gacagccgctggttcgagatgctgcccaacttggaaatcctcatgattggcggcaacaag
gtggatgccatcttggacatgaacttccggcccctggccaacctgcgcagcctggtgctg
gcaggcatgagcttgcgggagatctcagactacgctctggagggactgcaaagcctggag
agtctctctttctacgacaatcagctggcccaggtgcccaagcgggcattggagcaggtg
cctgggctcaagttcctagacctgaacaaaaacccactgcagcgggtcggaccgggagac
tttgccaacatgctgcacctcaaggaactaggactaaacaacatggaggaactggtctcc
atcgacaagtttgctctggtaaatctccctgagctgaccaagttggacatcaccaacaac
ccacggctttctttcatccatcctcgcgcctttcaccacctgccccagatggagactctc
atgctcaacaacaatgctctcagtgccttgcaccagcagacagtggagtctctgcccaac
ctacaggaggtggggctccacggcaaccccatccgctgtgactgtgtcatccgctgggcc
aacgccacgggcacccacgtccgtttcatcgaaccacagtccaccctgtgtgctgagcct
ccagaccttcagcgccgcccagtccgggaggtgcccttccgggagatgacagaccactgc
ctgcccctcatctctccccgaagtttcccctccagtctgcagatagccagtggagagagc
acggtacttcactgtcgggcactggctgaaccagaacctgagatctactgggtcacccca
gctggagttcgactgacacctgctcgctcaggcaggaggtaccgagtgttccctgagggt
accctagagttgcggagggtgacggcggaagaggcaggcctatacacctgtgtggcccag
aacttggtaggggctgacactaaaaccgtcagtgttgtggttggccacgctcccttccag
ccaggcagggacaaaggaccaggactgaagctccatgtgcaggagacacacccatatcac
atcctgctgttttgggcacccccacccaatatagtctccaccaacctcacctggtctagc
gcctcctccctccgggaccatgaagctcctgctttggcccgactgccgcggggcacccac
cgctacaacattacccgcctccttccggccacagagtactgggcctgcctgcaagtggcc
tttgctgatgcccacacccagttggcttgtgtttgggccaggactaaagaggcctctcct
tgccacagagccctgggggaccggcccgggctcatagccatcctggctcttgcggtcctc
ctgctggcagctgggcttgcagcccacctcggcagaggccagtccaagcagggggtggtg
ggtgagaagcctcttcttccggtctgggctttctggggctggagcgccccctctgtccgg
gtagtgtctgcaccccttgtcctgccctggaatccagggaggaagcagcccagatgtcag
atggggagagggtgccaccaccattgtctcaacattgctgaagttccgccaggtctcagc
agtagagaaataactaggacaactctacactaa

DBGET integrated database retrieval system