KEGG   Mus musculus (mouse): 16988
Entry
16988             CDS       T01002                                 

Gene name
Lst1, B144
Definition
(RefSeq) leukocyte specific transcript 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LST1 Herpes_gE FAM163 HupH_C Baculo_11_kDa
Other DBs
NCBI-GeneID: 16988
NCBI-ProteinID: NP_034864
MGI: 1096324
Ensembl: ENSMUSG00000073412
Vega: OTTMUSG00000033230
UniProt: B8JJ61
Position
17 B1; 17 18.59 cM
AA seq 93 aa
MTMGSGNNCTTNDFLLNGSLGLGGLLLLLVIILFICLCRFSQRVKRLERNAQVSGQEPHY
ASLQQLPVSSSDITDMKEDLSTDYACIARSTPT
NT seq 282 nt   +upstreamnt  +downstreamnt
atgacaatgggatctggtaacaattgcacaaccaatgatttcctgctaaatgggagcctg
ggactgggagggctcctcctcctgcttgtcatcatcctgttcatctgcttgtgccggttc
agtcagagagtgaagagactggaaaggaatgcccaggtctcagggcaggagccccactat
gcatctctccagcagctgccagtgtccagtagtgatatcacagacatgaaagaagacctc
agcactgactatgcctgcatcgccaggagcacacccacttga

DBGET integrated database retrieval system