KEGG   Mus musculus (mouse): 16997
Entry
16997             CDS       T01002                                 

Gene name
Ltbp2, AW208642
Definition
(RefSeq) latent transforming growth factor beta binding protein 2
  KO
K08023  latent transforming growth factor beta binding protein 2/3/4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    16997 (Ltbp2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   16997 (Ltbp2)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF hEGF EGF_3 FXa_inhibition EGF_2
Other DBs
NCBI-GeneID: 16997
NCBI-ProteinID: NP_038617
MGI: 99502
Ensembl: ENSMUSG00000002020
Vega: OTTMUSG00000036546
UniProt: O08999 Q0VD84
Position
12; 12 D1
AA seq 1766 aa
MRAPTTARCSGCIRRVRWRGFLPLVLAVLMGTSHAQRDSIGRYEPASRDANRLWHPVGSH
PAAAAAKVYSLFREPDAPVPGLSPSEWNQPAQGNPGRLAEAEARRPPRTQQLRRVQPPVQ
TRRSHPRGQQQIAARAAPSVARLETPQRPAAARRGRLTGRNVCGGQCCPGWTTSNSTNHC
IKPVCQPPCQNRGSCSRPQVCICRSGFRGARCEEVIPEEEFDPQNARPVPRRSVERAPGP
HRSSEARGSLVTRIQPLVPPPSPPPSRRLSQPWPLQQHSGPSRTVRRYPATGANGQLMSN
ALPSGLELRDSSPQAAHVNHLSPPWGLNLTEKIKKIKVVFTPTICKQTCARGRCANSCEK
GDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGKFCHLPVPQPD
REPAGRGSRHRTLLEGPLKQSTFTLPLSNQLASVNPSLVKVQIHHPPEASVQIHQVARVR
GELDPVLEDNSVETRASRRPHGNLGHSPWASNSIPARAGEAPRPPPVLSRHYGLLGQCYL
STVNGQCANPLGELTSQEDCCGSVGTFWGVTSCAPCPPRPAFPVIENGQLECPQGYKRLN
LSHCQDINECLTLGLCKDSECVNTRGSYLCTCRPGLMLDPSRSRCVSDKAVSMQQGLCYR
SLGSGTCTLPLVHRITKQICCCSRVGKAWGSTCEQCPLPGTEAFREICPAGHGYTYSSSD
IRLSMRKAEEEELASPLREQTEQSTAPPPGQAERQPLRAATATWIEAETLPDKGDSRAVQ
ITTSAPHLPARVPGDATGRPAPSLPGQGIPESPAEEQVIPSSDVLVTHSPPDFDPCFAGA
SNICGPGTCVSLPNGYRCVCSPGYQLHPSQDYCTDIDECEQPGVCSGGRCSNTEGSYHCE
CDRGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYVGQSGSCVDVNECL
TPGICTHGRCINMEGSFRCSCEPGYEVTPDKKGCRDVDECASRASCPTGLCLNTEGSFTC
SACQSGYWVNEDGTACEDLDECAFPGVCPTGVCTNTVGSFSCKDCDRGYRPNPLGNRCED
VDECEGPQSSCRGGECKNTEGSYQCLCHQGFQLVNGTMCEDVNECVGEEHCAPHGECLNS
LGSFFCLCAPGFASAEGGTRCQDVDECAATDPCPGGHCVNTEGSFSCLCETGFQPSPDSG
ECLDIDECEDREDPVCGAWRCENSPGSYRCILDCQPGFYVAPNGDCIDIDECANDTVCGN
HGFCDNTDGSFRCLCDQGFETSPSGWECVDVNECELMMAVCGDALCENVEGSFLCLCASD
LEEYDAEEGHCRPRVAGAQRIPEVRTEDQAPSLIRMECYSEHNGGPPCSQILGQNSTQAE
CCCTQGARWGKACAPCPSEDSVEFSQLCPSGQGYIPVEGAWTFGQTMYTDADECVLFGPA
LCQNGRCLNIVPGYICLCNPGYHYDASSRKCQDHNECQDLACENGECVNTEGSFHCLCNP
PLTLDLSGQRCVNSTSSTEDFPDHDIHMDICWKKVTNDVCSQPLRGHHTTYTECCCQDGE
AWSQQCALCPPRSSEVYAQLCNVARIEAERGAGIHFRPGYEYGPGLDDLPENLYGPDGAP
FYNYLGPEDTAPEPPFSNPASQPGDNTPVLEPPLQPSELQPHYLASHSEPLASFEGLQAE
ECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECEDLNGPAALCAHGHCEN
TEGSYRCHCSPGYVAEPGPPHCAAKE
NT seq 5301 nt   +upstreamnt  +downstreamnt
atgagagcgccgaccaccgctcgctgctccggatgcatccgacgggtgcgttggaggggc
ttcctgccacttgtcctggctgtcttgatggggacaagtcatgcccaacgggattccata
gggagatacgaaccagctagcagggatgcgaatcggttgtggcaccccgtgggcagccac
cccgcagcggctgcagccaaggtgtacagtctgttccgagagcctgacgcgccggtcccc
ggcttgtcgccctctgagtggaaccagccggcccaggggaaccctgggaggctcgcagag
gccgaggccaggaggccaccccgaacccagcagctgcgtcgagtccagccacctgtccag
actcggagaagccatccccggggccagcagcagatagcagccagggctgcaccttctgtc
gcgcgcctggaaacccctcagcgacccgcggctgcacggcgagggcggctcaccgggaga
aatgtctgcgggggacagtgctgcccaggatggacaacatcaaacagcaccaaccactgt
atcaaacctgtgtgtcagcctccctgtcagaaccgaggctcctgcagcaggccccaggtc
tgtatctgccgttctggcttccgtggggcgcgctgtgaggaggtcatccctgaggaggaa
tttgaccctcagaatgccaggcctgtgcccagacgctcagtggagagagcacccggtcct
cacagaagcagtgaggccagaggaagtctagtgaccagaatacagccgctggtaccacca
ccatcaccacctccatctcggcgcctcagccagccctggcccctgcagcagcactcaggg
ccgtccaggacagttcgtcggtatccggccactggtgccaatggccagctgatgtccaac
gctttgccttcaggactcgagctgagagacagcagcccacaggcagcacatgtgaaccat
ctctcacccccctgggggctgaacctcaccgagaaaatcaagaaaatcaaagtcgtcttc
acccccaccatctgcaagcagacctgtgcccggggacgctgtgccaacagctgtgagaag
ggtgacaccaccaccttgtacagtcagggtggccatgggcatgaccccaagtctggcttc
cgtatctatttctgccaaatcccctgcctgaatggtggccgctgcatcggccgggacgag
tgctggtgtccagccaactccacaggaaagttctgccatctgcctgtcccgcagccagac
agggaacctgcagggcgaggttcccggcacagaaccctgctggaaggtcccctgaagcaa
tccaccttcacgctgcctctctctaaccagctcgcctctgtgaacccctcgctggtgaag
gtgcaaattcatcacccgcctgaggcctctgtgcagattcaccaggtggcccgggtccgg
ggtgagctggaccccgtgctggaggacaacagtgtggagaccagagcctctcgtcgcccc
cacggcaacctaggccacagcccctgggccagcaacagcatacccgctcgggccggagag
gcccctcggccaccaccagtgctgtctaggcattatggacttctgggccagtgttacctg
agcacggtgaatggacagtgtgctaaccccctaggggagctgacttctcaggaggactgc
tgtggcagtgtggggaccttctggggggtgacctcctgtgctccctgcccacccagacca
gccttcccagtgattgaaaatggccagctggagtgtccccaaggatacaagagactgaac
ctcagccactgccaagatatcaatgagtgcctgaccctgggcctctgcaaggactcggag
tgcgtgaacaccaggggcagctacctgtgcacctgcaggcctggcctcatgctggatccg
tcaaggagccgctgcgtatcggacaaggctgtctccatgcagcagggactatgctaccgg
tcactggggtctggtacctgcaccctgcctttggttcatcggatcaccaagcagatatgc
tgctgcagccgtgtgggcaaagcctggggtagcacatgtgaacagtgtcccctgcctggc
acagaagccttcagggagatctgccctgctggccatggctacacctactcgagctcagac
atccgcctgtctatgaggaaagccgaagaagaggaactggctagccccttaagggagcag
acagagcagagcactgcacccccacctgggcaagcagagaggcaaccactccgggcagcc
accgccacctggattgaggctgagaccctccctgacaaaggtgactctcgggctgttcag
atcacaaccagtgctccccacctacctgcccgggtaccaggggatgccactggaagacca
gcaccatccttgcctggacagggcattccagagagtccagcagaagagcaagtgattccc
tccagtgatgtcttggtgacacacagccccccagactttgatccatgttttgctggagcc
tccaacatctgtggccctgggacctgtgtgagcctcccaaatggatacagatgtgtctgc
agccctggctaccagctacaccccagccaagactactgtactgatatcgatgagtgtgag
cagcccggggtgtgcagtggtgggcgatgcagcaacacggagggctcgtaccactgcgag
tgtgatcggggctacatcatggtcaggaaaggacactgtcaagatatcaacgaatgccgt
caccctggtacctgccctgatgggagatgcgtcaactcccctggctcctacacttgtctg
gcctgtgaggagggctatgtaggccagagtgggagctgtgtagatgtcaatgagtgtctg
acccctgggatatgtacccatggaaggtgcatcaacatggaaggctcctttagatgctcc
tgtgagccgggctatgaggtcaccccagacaagaagggctgccgagatgtggacgagtgt
gccagccgagcctcgtgccccaccggcctctgcctcaacacggagggctccttcacctgc
tcagcctgtcagagcgggtactgggtgaacgaagatggcactgcctgtgaagacttggat
gaatgtgccttccctggagtctgccccacaggcgtctgcaccaatactgtaggctccttc
tcctgcaaggactgtgacaggggctaccggcccaaccccctgggcaacagatgcgaagat
gtggatgagtgtgaaggtccccaaagcagctgccggggaggcgaatgcaagaacacagaa
ggttcctaccaatgcctctgtcaccagggcttccagctggtcaatggcaccatgtgtgag
gacgtgaatgagtgtgttggggaagagcattgtgctcctcacggcgagtgcctcaacagc
ctgggctccttcttctgcctctgtgcacccggctttgctagtgctgaggggggcaccaga
tgccaggatgttgatgaatgtgcagccacagacccgtgtccgggaggacactgtgtcaac
acagagggctccttcagctgtctgtgtgagactggcttccagccctccccagacagcgga
gaatgtttggatattgatgagtgtgaggaccgtgaagacccggtgtgcggagcctggagg
tgtgagaacagtcctggttcctaccgctgcatcctggactgccagcctggcttctatgtg
gcgccaaatggagactgcattgacatagatgaatgtgccaatgacactgtgtgtgggaac
catggcttctgtgacaacacggacggctccttccgctgcctgtgtgaccagggcttcgag
acctcaccatcaggctgggagtgtgttgatgtgaacgagtgtgagctcatgatggcagtg
tgtggggatgcgctctgtgagaacgtggaaggctccttcctgtgcctttgcgccagtgac
cttgaggagtacgacgcagaagaaggacactgccgtcctcgggtggctggagctcagaga
atcccagaggtccggacagaggaccaggctccaagccttatccgcatggaatgctactct
gaacacaatggtggtcctccctgctctcaaatcctgggccagaactccacacaggccgag
tgctgctgcactcagggtgccagatggggaaaggcctgtgcgccctgcccatctgaggac
tcagttgaattcagtcagctctgccccagtggtcaaggttacatcccagtggaaggagcc
tggacatttggacaaaccatgtatacagatgccgatgaatgtgtactgtttgggcctgct
ctctgccagaatggccgatgcctcaacatagtgcctggctacatttgcctgtgcaaccct
ggctaccactatgatgcctccagcaggaagtgccaggatcacaacgaatgccaggacttg
gcctgtgagaacggtgagtgtgtgaacacagaaggctccttccattgcctctgcaatccc
cccctcaccctagacctcagtgggcagcgctgtgtgaacagcaccagcagcacggaggac
ttccctgaccatgacatccacatggacatctgctggaaaaaagtcaccaatgatgtgtgc
agccagcccttgcgtgggcaccataccacctatacagaatgctgctgccaagatggggag
gcctggagccagcaatgcgctctgtgcccgcccaggagctctgaggtctacgctcagctg
tgcaacgtggctcggattgaggcagagcgcggagcagggatccacttccggccaggctat
gagtatggccctggcctggacgatctgcctgaaaacctctacggcccagatggggctccc
ttctataactacctaggccccgaggacactgcccctgagcctcccttctccaacccagcc
agccagccgggagacaacacacctgtccttgagcctcctctgcagccctctgaacttcag
cctcactatctagccagccactcagaacccctggcctccttcgaaggccttcaggctgag
gaatgtggcatcctgaatggctgtgagaatggccgctgcgtgcgtgtgcgggagggctac
acttgcgactgctttgagggcttccagctggatgcggcccacatggcctgtgtggatgtg
aacgagtgtgaagacttgaacgggcctgcagcactctgtgcacacggtcactgtgagaac
acagagggttcctatcgctgccactgttcgccaggttacgtggcagagccaggcccccca
cactgtgcggccaaggagtag

DBGET integrated database retrieval system