KEGG   Mus musculus (mouse): 17022
Entry
17022             CDS       T01002                                 

Gene name
Lum, Ld, Ldc, SL, SLRR2D
Definition
(RefSeq) lumican
  KO
K08122  lumican
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    17022 (Lum)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    17022 (Lum)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    17022 (Lum)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6 LRRNT LRR_9 LRR_5
Other DBs
NCBI-GeneID: 17022
NCBI-ProteinID: NP_032550
MGI: 109347
Ensembl: ENSMUSG00000036446
UniProt: P51885
Position
10 C3; 10 50.32 cM
AA seq 338 aa
MNVCAFSLALALVGSVSGQYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKK
LHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASL
KGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNE
LADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGP
LSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaatgtatgtgcgttctctcttgccttggcattagtcggtagtgtcagtggccaatac
tacgattatgacatccctctcttcatgtatgggcaaatatcacccaactgtgcaccagaa
tgtaactgcccccacagctacccaactgccatgtactgtgatgacctcaagttgaagagt
gtgccaatggttcctcctggcatcaagtacctttacctgaggaataaccaaatcgaccat
attgatgagaaggcctttgagaacgtcacagacctgcagtggctcattcttgaccacaac
cttctagaaaactccaagatcaaaggaaaggttttctctaagctgaaacaactgaagaaa
ctgcatataaactacaacaacctgaccgagtccgtcggtccacttccaaagtccctgcaa
gacctacagctgaccaataataaaatcagcaagctcggctccttcgacgggctggtcaac
ttgaccttcatttatcttcaacacaaccagctcaaagaggatgctgtctcggcttctctg
aaaggtctcaaatcactagagtacctggatttgagcttcaatcagatgagcaagctgcct
gctggtctacctacatctcttctaactctctacctagacaataataagatcagcaacatt
ccggatgagtacttcaagcgcttcactgggctgcaatacctgcgtttatctcacaatgaa
ctggctgatagtggggtacctggaaactcgtttaatatatcatccttgctcgagcttgat
ctctcctataataagcttaagagtataccaacagttaatgaaaatcttgaaaattattac
ctggaggtcaatgaacttgaaaagtttgatgtgaagagcttctgtaagatcctgggacca
ctgtcttactccaagatcaagcatctgcgcttggatggcaatcctctcactcagagcagt
ctgcctcctgacatgtatgagtgtctacgtgtagcaaatgaaatcaccgttaactaa

DBGET integrated database retrieval system