KEGG   Mus musculus (mouse): 170439Help
Entry
170439            CDS       T01002                                 

Gene name
Elovl6, C77826, FAE, LCE
Definition
(RefSeq) ELOVL family member 6, elongation of long chain fatty acids (yeast)
  KO
K10203  elongation of very long chain fatty acids protein 6 [EC:2.3.1.199]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01212  Fatty acid metabolism
Module
mmu_M00415  Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    170439 (Elovl6)
   01040 Biosynthesis of unsaturated fatty acids
    170439 (Elovl6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    170439 (Elovl6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     170439 (Elovl6)
Lipid biosynthesis proteins [BR:mmu01004]
 Elongase
  PUFA
   170439 (Elovl6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 170439
NCBI-ProteinID: NP_569717
MGI: 2156528
Ensembl: ENSMUSG00000041220
Vega: OTTMUSG00000054039
UniProt: Q920L5
Position
3; 3 G3
AA seq 267 aa AA seqDB search
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
KPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSK
APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY
YALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLM
YLSYLVLFCHFFFEAYIGKVKKATKAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtcagtgttgactttacaagaatatgaattcgaaaagcagttcaacgagaac
gaagccatccaatggatgcaggaaaactggaagaagtctttcctgttttctgcgctgtac
gctgcctttatctttggtggtcggcatctgatgaacaagcgagccaagtttgaacttcgg
aagccgctcgtgctctggtcgctgactcttgccgtcttcagtatattcggtgctcttcga
actggtgcttacatgctgtacattctgatgaccaaaggcctgaagcagtcagtttgtgac
cagagtttttacaatggacctgtcagcaaattctgggcttatgcatttgtgctcagcaaa
gcacccgaactaggtgacacgatattcatcattctgaggaaacagaaactgatcttcctg
cactggtaccaccacatcactgtgctcctgtactcctggtactcctacaaagacatggtc
gctgggggtggttggttcatgactatgaactatggcgtgcatgccgtcatgtactcttac
tacgccttgcgggctgcgggtttccgagtctcccggaagtttgccatgttcatcaccttg
tcccagatcactcagatgctgatgggctgtgtcattaactacctggtcttcaactggatg
cagcatgacaacgaccagtgctactcccactttcagaacatcttctggtcctcgctcatg
tacctcagctaccttgtgctcttctgccatttcttctttgaggcctacatcggcaaagtg
aagaaagccacgaaggctgagtag

DBGET integrated database retrieval system