KEGG   Mus musculus (mouse): 170472
Entry
170472            CDS       T01002                                 

Gene name
Recql5, RecQ5, Recq5b, Recql, Recql5b
Definition
(RefSeq) RecQ protein-like 5
  KO
K10902  ATP-dependent DNA helicase Q5 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    170472 (Recql5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     170472 (Recql5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     170472 (Recql5)
SSDB
Motif
Pfam: RecQ5 DEAD Helicase_C RecQ_Zn_bind ResIII TFIIS_M KIX_2 SRI
Other DBs
NCBI-GeneID: 170472
NCBI-ProteinID: NP_569721
MGI: 2156841
Ensembl: ENSMUSG00000020752
Vega: OTTMUSG00000003617
UniProt: Q8VID5
Position
11; 11 E2
AA seq 982 aa
MSARPFSTPFDRERRVRSTLKKVFGFDSFKTPLQESATMAVVKGAEDVFVCMPTGAGKSL
CYQLPALLASGITIVVSPLIALIQDQVDHLLALKVQVSSLNSKLSVQERKELLSDLERDK
PRTKLLYITPEMAASASFQPTLNSLVSRNLLSYLVVDEAHCVSQWGHDFRPDYLRLGALR
SRLAHAPCVALTATATPQVQEDVFAALHLKQPVASFKTPCFRANLFYDVQFKELIPDVYG
NLRDFCLKALGQKAENGSSSGCGIVYCRTREACEQLAIELSSRGVNAKAYHAGLKASDRT
QVQNEWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWC
RLYYSRNDRDQVSFLIRKELAKLQEKRGNKPSDKATLLAFDALVTFCEEVGCRHAAIAKY
FGDAPPACAKGCDYCQNPAAITKKLDALERSSSWSKTCIGPSQGNGFDPELYEGGRRGYG
GFSRYDEGSGGSGDEGRDEAHKREWNLFYQKQMSLRKGKEPKIEEFTPPDEDCPLREASS
RKIPKLTVKAREHCLRLLEEALISNHQAAGSTHGADLQAKAVELEHETFRNAKMVNLYKA
SVLKKVAEIHKASKDGQLYDMESGTKSCGAAAEFSEPSDYDIPPTSHVYSLKPKRVGAGF
SKGPCSFQTATELLGKSHSQKQAPEAMLEGGQEPPGWVCDLQDEDRSKPHPGYQEKALGS
SVNCGDPSPEKKTKGSSQGSAKARASKKQQLLATAARKDSQNITRFLCQRTESPPLPASV
PRSEDASPSCGDVPGKCTQEVGAQGHLVAVFQTEGPRERPSTCSLRDQSFPEGQPSPLKE
TQAEKRPRPQQGNPERRAQKRLRPSTKSSILAEAKDSTLASDRSTENKVAQEPCQLSASG
TSLREAADIVVRHLTPFYKEGRFISKDLFKGFARHLSHLLAQQLSPGRSVKEEAQSLIKQ
FFHNRARCESEADWHSLRGPQR
NT seq 2949 nt   +upstreamnt  +downstreamnt
atgagcgcccgtcctttctccactcccttcgaccgggagcggcgagtccggagcaccctg
aagaaagtctttgggtttgattcttttaaaacacctttacaagagagtgcgaccatggct
gtagtgaaaggtgccgaggatgtgtttgtgtgcatgcccacaggggcagggaagtctctg
tgctatcaactccctgccctgttggccagtgggatcaccattgtagtctctcctctcatt
gccttgattcaggaccaggtagaccatttgctggccttgaaggtacaagttagttccctg
aactcaaagctctcggtacaggagaggaaggagctgctgtctgacctggagcgagacaaa
cctcggaccaaacttttgtacatcaccccagagatggcagcttcagcctccttccagccc
accctgaattccctggtgtcccgaaacctgctctcctacttggtggtggatgaagctcat
tgcgtttcccagtggggacatgacttccgtcctgactatttgcgtctgggtgccctacgt
tcccgcttggcacatgccccgtgcgtggctctgacggctacagccaccccacaggttcaa
gaggatgtgtttgctgccctgcacttgaagcagccagtcgcctctttcaagactccctgt
ttccgggccaacctcttctatgatgtgcagttcaaggaactgattcccgacgtctatggc
aatctgagggacttctgccttaaggctcttggacagaaggctgagaacgggtcgtcctct
ggctgtggcattgtctactgcaggactagagaagcttgtgaacaactggccattgagctc
agcagcaggggtgtgaacgccaaggcttaccacgcaggcctgaaggcatctgatagaaca
caggtacagaacgagtggatggaggagaaggtccctgtaattgttgcgaccatcagtttt
gggatgggagtagacaaagctaatgtccggtttgttgctcattggaatattgccaagtcc
atggctggctactaccaggagtctggccgtgctggcagggatggcaaaccatcttggtgc
cgcctgtattactctaggaatgaccgagaccaagtcagcttccttatcaggaaggaacta
gccaaactccaggaaaagagggggaacaaaccgtctgataaggccaccctgctggccttt
gatgccctggtgaccttctgtgaagaagtggggtgccgccatgctgccattgctaagtac
tttggggatgcaccccccgcctgcgccaaaggctgtgactactgccagaatcctgcagcc
ataacgaagaagctggatgccctggagcgcagcagcagctggagcaagacctgcatcggg
ccctcacaggggaatggcttcgatcctgagctgtatgagggaggccgcaggggctatggt
ggcttcagcaggtatgatgaaggttctggaggtagcggtgatgagggcagagatgaggcc
cacaagcgggaatggaatcttttctatcagaaacagatgagcctgcgcaagggcaaagag
cccaagatagaagaattcacgcccccagatgaagactgtcccctgagagaggcttcaagc
aggaagatcccgaagctcacagtgaaggcccgtgagcactgcctgcgacttctggaggag
gctctgatcagtaaccatcaggctgcaggctccactcatggagctgacctgcaggccaag
gctgtggaactggagcatgagacattccggaatgccaagatggtcaatctgtacaaggcc
agtgtcctgaagaaggtggccgagatccacaaagcctccaaggatggtcagctctatgac
atggaaagcggcaccaagagctgtggggccgcagctgagttctcggagcccagtgactat
gacatcccgccaacctcacatgtgtactcgctcaaacccaagagagtaggagctggcttc
tccaaaggcccctgctcattccagacagccacagaactgttggggaagtctcactcccag
aagcaagccccagaggctatgctagagggtggacaggagcccccaggctgggtctgtgac
cttcaagatgaagacaggagcaagccccaccctgggtaccaagaaaaggctctaggaagc
agtgttaattgtggggacccctcgcctgagaagaagacgaaagggtcttcccagggcagt
gccaaagctagagccagcaagaaacaacagctcctagccacagcagcccgcaaggattcc
cagaatatcactcgattcctctgtcagaggacagaatctccacctctccctgcttcagtt
ccaagatcagaagatgccagcccctcctgtggggatgtcccagggaagtgcacacaagag
gttggagctcagggacatttggttgctgtatttcagactgagggtcccagggagaggcca
agcacctgctcactcagagaccagagcttccctgaaggtcagcctagccctctaaaggaa
acccaggcagagaagcggcccagaccacagcagggcaacccagagagaagggctcaaaag
aggcttcgcccctcaaccaagtcctccatcttggctgaggccaaggacagtaccttggcc
agtgatcgcagcactgaaaacaaagtggctcaagaaccctgccagctctcagcatctggc
acctccctgagggaggccgcagacattgtggtcaggcacctgacccccttctacaaggag
ggcaggtttatatccaaggacctgtttaagggctttgcccgccacctctcacatttgctg
gctcagcagctctctcctggaaggagtgtgaaggaagaggcccagagcctcatcaagcag
ttcttccacaatcgtgcccgctgtgagagtgaagctgactggcacagcctgcgtggccca
cagcgatga

DBGET integrated database retrieval system