KEGG   Mus musculus (mouse): 170484Help
Entry
170484            CDS       T01002                                 

Gene name
Nphs2, PDCN, SRN1
Definition
(RefSeq) nephrosis 2, podocin
  KO
K18268  podocin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    170484 (Nphs2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   170484 (Nphs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 GatB_N Phage_holin_2_1
Motif
Other DBs
NCBI-GeneID: 170484
NCBI-ProteinID: NP_569723
MGI: 2157018
Ensembl: ENSMUSG00000026602
Vega: OTTMUSG00000050345
UniProt: Q91X05 C0LL94
Position
1; 1 G3
AA seq 385 aa AA seqDB search
MDSRARSSSREAHGRSSRSSSRDDKKAKAGRGSRGRARPDAGAERQSTGRTATRGEPRAP
AATATVVDVDEVRGPGEEGTEVVALLESERPEEGIKPSGLGACEWLLVLASLIFIIMTFP
FSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHE
VVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLER
KSIAQDVKVALDAVTCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGE
KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLSLLSSPGNRAQ
GSINYPSSSKPVEPLNPKKKDSPML
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagggcgcggagctcttcccgagaggcccacgggagaagtagcaggtcctcc
tctagggatgacaagaaggcaaaggccgggaggggcagcagaggccgcgcacgtccggat
gctggagcagagcggcagagcaccgggcggacagcgacccgaggggagccccgagctccc
gctgccaccgccaccgtagtggacgtggacgaggttcggggccctggtgaggagggcacg
gaagtggtggcgctgctggagagcgagcgaccagaggaaggcatcaagccctctggatta
ggggcctgcgagtggcttcttgtcctcgcctccctgatcttcatcatcatgacgttccct
ttttccatctggttctgcataaaggttgtgcaagagtatgaaagagtaattatattccga
ctgggacatctgcttcctggaagagccaaaggtcctggcctgttcttttttttaccctgt
ctggacacctatcacaaggttgatctccgtctccagaccttggaaatacctttccatgag
gtggtaaccaaagatatgtttataatggagatagacgctgtctgctactaccgcatggaa
aatgcctctcttcttctaagcagtctagcccatgtgtccaaagccatccagttcctggtg
caaaccaccatgaagcgcctcttggcacatcgatccctcactgaaattctcctggaaagg
aagagcattgcccaagatgtaaaggttgccttagatgcagtgacctgtatttggggcatc
aaagtggagagaactgaaattaaggatgtgaggctgccagctgggcttcagcactctctg
gcggtggaagctgaggcacaaagacaggccaaagtgcgggtgattgctgcagaaggggaa
aaggctgcttcagagtccctgaggatggcggctgagattctgtcgggcaccccagccgct
gtccagcttcgatacttgcacactcttcagtcgctgtccacagagaagccagccactgtg
gttttgcctttgccatttgacatgctaagccttttgtcctctcccggcaacagagcacaa
gggagcatcaactacccaagttcctccaaaccagttgaaccactaaatcccaaaaagaag
gactctcctatgttatag

DBGET integrated database retrieval system