KEGG   Mus musculus (mouse): 17059
Entry
17059             CDS       T01002                                 

Gene name
Klrb1c, AI462337, CD161, Klrb1b, Ly-5, Ly-59, Ly5, Ly55, Ly55c, Ly59, NK-, NK-1., NK-RP1, NK1.1, NKR, NKR-, NKR-P1.9, NKRP1, NKRP140, Nk, Nk-1, Nk-1.2, Nk1, Nk1., Nk1.2, Nkrp, Nkrp1b, Nkrp1c, ly-55c
Definition
(RefSeq) killer cell lectin-like receptor subfamily B member 1C
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    17059 (Klrb1c)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    17059 (Klrb1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    17059 (Klrb1c)
   04091 Lectins [BR:mmu04091]
    17059 (Klrb1c)
CD molecules [BR:mmu04090]
 Proteins
  17059 (Klrb1c)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   17059 (Klrb1c)
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 17059
NCBI-ProteinID: NP_032553
MGI: 107538
Ensembl: ENSMUSG00000030325
Vega: OTTMUSG00000037663
UniProt: P27814 E9Q3U6
Position
6 F3; 6 63.09 cM
AA seq 268 aa
MEKPSETGISGCGNRAEHSQRTFFCLFHLKGLGVCPFSPPVKCCISCEMDTASIYLGLKP
PRTLGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVLTLIGMSVLVRVLVQKPSRE
KCCVFIQENLNKTTVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQ
EELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGD
KVTPESCASDNRWICQKELNHETPSNDS
NT seq 807 nt   +upstreamnt  +downstreamnt
atggagaaaccctcagagacaggaatcagtgggtgtgggaacagagcagagcattcacag
aggactttcttttgcttatttcacctcaaaggccttggagtttgtcccttctcaccacca
gttaagtgttgcatctcctgtgaaatggacacagcaagtatctacctcggtttaaagcca
cccaggacactgggggcttggcatgagtcacccccatctcttcccccagatgcctgtcgg
tgcccacgttcacacaggttggctctgaagctcagctgtgctgggctcatcctccttgtc
ctgaccctgattgggatgagtgtcttagtgcgagtcttagtacaaaaaccatcaagagaa
aaatgctgtgtgtttattcaagagaacctgaataaaacaacagttaatttagagtgccca
caagactggcttttacaccgagataagtgctttcacgtttctcaagtttccaacacttgg
gaggaaggtcaagctgactgtggtagaaaaggagccactttgctgctcattcaagaccaa
gaagaactgagattcctactggactcaataaaggaaaaatataattcattttggattgga
ctaaggttcacattgccagacatgaactggaagtggataaatggcacaactttcaattct
gatgtactaaaaatcactggtgtcactgaaaatggcagctgtgcctccatcttaggagat
aaagtgactcctgagagctgtgcttcagacaaccgttggatctgccaaaaggaactaaac
catgaaaccccgagtaatgactcctga

DBGET integrated database retrieval system