KEGG   Mus musculus (mouse): 17064Help
Entry
17064             CDS       T01002                                 

Gene name
Cd93, 6030404G09Rik, AA145088, AA4.1, AW555904, C1qr1, C1qrp, Ly68
Definition
(RefSeq) CD93 antigen
  KO
K06702  CDW93 antigen
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    17064 (Cd93)
   04091 Lectins [BR:mmu04091]
    17064 (Cd93)
CD molecules [BR:mmu04090]
 Proteins
  17064 (Cd93)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 14: Thrombomodulin
   17064 (Cd93)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cEGF EGF_CA FXa_inhibition EGF Lectin_C EGF_3 TMEM154 hEGF DUF2207
Motif
Other DBs
NCBI-GeneID: 17064
NCBI-ProteinID: NP_034870
MGI: 106664
Ensembl: ENSMUSG00000027435
Vega: OTTMUSG00000015713
UniProt: O89103
Position
2 G3; 2 73.48 cM
AA seq 644 aa AA seqDB search
MAISTGLFLLLGLLGQPWAGAAADSQAVVCEGTACYTAHWGKLSAAEAQHRCNENGGNLA
TVKSEEEARHVQQALTQLLKTKAPLEAKMGKFWIGLQREKGNCTYHDLPMRGFSWVGGGE
DTAYSNWYKASKSSCIFKRCVSLILDLSLTPHPSHLPKWHESPCGTPEAPGNSIEGFLCK
FNFKGMCRPLALGGPGRVTYTTPFQATTSSLEAVPFASVANVACGDEAKSETHYFLCNEK
TPGIFHWGSSGPLCVSPKFGCSFNNGGCQQDCFEGGDGSFRCGCRPGFRLLDDLVTCASR
NPCSSNPCTGGGMCHSVPLSENYTCRCPSGYQLDSSQVHCVDIDECQDSPCAQDCVNTLG
SFHCECWVGYQPSGPKEEACEDVDECAAANSPCAQGCINTDGSFYCSCKEGYIVSGEDST
QCEDIDECSDARGNPCDSLCFNTDGSFRCGCPPGWELAPNGVFCSRGTVFSELPARPPQK
EDNDDRKESTMPPTEMPSSPSGSKDVSNRAQTTGLFVQSDIPTASVPLEIEIPSEVSDVW
FELGTYLPTTSGHSKPTHEDSVSAHSDTDGQNLLLFYILGTVVAISLLLVLALGILIYHK
RRAKKEEIKEKKPQNAADSYSWVPERAESQAPENQYSPTPGTDC
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggccatctcaactggtttgttcctgctgctggggctccttggccagccctgggcaggg
gctgctgctgattcacaggctgtggtgtgcgaggggactgcctgctatacagcccattgg
ggcaagctgagtgccgctgaagcccagcatcgctgcaatgagaatggaggcaatcttgcc
accgtgaagagtgaggaggaggcccggcatgttcagcaagccctgactcagctcctgaag
accaaggcacccttggaagcaaagatgggcaaattctggatcgggctccagcgagagaag
ggcaactgtacgtaccatgatttgccaatgaggggcttcagctgggtgggtggtggagag
gacacagcttattcaaactggtacaaagccagcaagagctcctgtatctttaaacgctgt
gtgtccctcatactggacctgtccttgacacctcaccccagccatctgcccaagtggcat
gagagtccctgtgggacccccgaagctccaggtaacagcattgaaggtttcctgtgcaag
ttcaacttcaaaggcatgtgtaggccactggcgctgggtggtccagggcgggtgacctat
accacccctttccaggccactacctcctctctggaggctgtgccttttgcctctgtagcc
aatgtagcttgtggggatgaagctaagagtgaaacccactatttcctatgcaatgaaaag
actccaggaatatttcactggggcagctcaggcccactctgtgtcagccccaagtttggt
tgcagtttcaacaacgggggctgccagcaggattgcttcgaaggtggcgatggctccttc
cgctgcggctgccggcctggatttcgactgctggatgatctagtaacttgtgcctccagg
aacccctgcagctcaaacccatgcacaggaggtggcatgtgccattctgtaccactcagt
gaaaactacacttgccgttgtcccagcggctaccagctggactctagccaagtgcactgt
gtggatatagatgagtgccaggactccccctgtgcccaggattgtgtcaacactctaggg
agcttccactgtgaatgttgggttggttaccaacccagtggccccaaggaagaggcctgt
gaagatgtggatgagtgtgcagctgccaactcgccctgtgcccaaggctgcatcaacact
gatggctctttctactgctcctgtaaagagggctatattgtgtctggggaagacagtacc
cagtgtgaggatatagatgagtgttcggacgcaaggggcaatccatgtgattccctgtgc
ttcaacacagatggttccttcaggtgtggctgcccgccaggctgggagctggctcccaat
ggggtcttttgtagcaggggcactgtgttttctgaactaccagccaggcctccccaaaag
gaagacaacgatgacagaaaggagagtactatgcctcctactgaaatgcccagttctcct
agtggctctaaggatgtctccaacagagcacagacaacaggtctcttcgtccaatcagat
attcccactgcctctgttccactagaaatagaaatccctagtgaagtatctgatgtctgg
ttcgagttgggcacatacctccccacgacctccggccacagcaagccgacacatgaagat
tctgtgtctgcacacagtgacaccgatgggcagaacctgcttctgttttacatcctgggg
acggtggtggccatctcactcttgctggtgctggccctagggattctcatttatcataaa
cggagagccaagaaggaggagataaaagagaagaagcctcagaatgcagccgacagctat
tcctgggttccagagcgagcagagagccaagccccggagaatcagtacagcccaacacca
gggacagactgctga

DBGET integrated database retrieval system