KEGG   Mus musculus (house mouse): 170644
Entry
170644            CDS       T01002                                 
Symbol
Ubn1, 1110029L11Rik, 2610108L02Rik
Name
(RefSeq) ubinuclein 1
  KO
K17492  ubinuclein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    170644 (Ubn1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    170644 (Ubn1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     170644 (Ubn1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    170644 (Ubn1)
SSDB
Motif
Pfam: UBN_AB HUN DUF3323
Other DBs
NCBI-GeneID: 170644
NCBI-ProteinID: NP_080942
MGI: 1891307
Ensembl: ENSMUSG00000039473
UniProt: Q4G0F8
Position
16:4867921..4904153
AA seq 1135 aa
MSEPHRVQFTSVPGSLNPAFLKKSRKEEVGGTEQHQDCEPAAAAVRITLTLFEPDHKRCP
EFFYPELVKNIRGKVKGLHPGDKKKDVLDPFNDEEKERHKVEALARKFEEKYGGKKRRKD
RIQDLIDMGYGYDESDSFIDNSEAYDELVPASLTTKYGGFYINSGTLQFRQASESEDDFI
KEKKKKSPKKRKLKEGGEKIKKKKKDDTYDKEKKSKKSKFSKAGFTALNASKEKKKKKYS
GSLSVREMLKKFQKEKEAQKKREEEHKPVAVSSIEAQGLRELEGTSDPLLSLFGSTSDND
LLQAATAMDSLTDLDLEQLLSESPEGSPFRDMDDGSDSLGVGLDQEFRQPSSFPEGLPIP
LEKRVKELAQAARAAEGESKQKFFTQDINGILLDIEVQTRELTSQIRSGVFAYLASFLPC
SKDALVKRARKLHLYEQGGRLKEPLQKLKDAIGRAMPEQVAKYQDECQAHTQAKVAKMLE
EEKDKEQRERICSDEEEDEEKGGRRIMGPRKKFQWNDEIRELLCQVVKIKLESRDLERNS
KAQAWEDCVKAFLDAEVKPLWPKGWMQARTLFKESRRGHGHLTSLLAKKKVIAPSKIKMK
ESSVKLDKKVSVPSGQHGGPTTLLSEHQGGGLNTGANSREHPSQATCGLTDSVSVTLEDS
LDEDLVRNPASSVDAVSKELATLNSRAANSSEFTLPTPSKAPTEKVGGVLCTEEKRNFAK
PSSSAPPPTNALQSPLNFLAEQALALGQSSQEKKPEGSGFKELSCQGPLSKGVPELHPSK
AKHHNLPRTSHGPQAAAPVPGPQVKVFHAGTQQQKSFTPPSPFVNKLQGPKATSPQCHRS
LLQLVKTAAKGQAFHATMPASSGSSPASSSSAHKTTASNSTTISHPAKLHPTSSVGPSYK
NNPFAGSVSKHGASSSSPSPGGGAQVQSSVSGASLPGVQSPSAGQSASRAAPSSAVKKTP
VTQKLTLVAPPGGPNGDSGGGTQGVAKLLTSSLKPAAVSSVTSSTSLPKGTGGAVLLSNT
SSLSLLSSSYKSNNPKLPGAMNSNSLGIITQFPLHVLSFNADSSAKAGVSKDAIVTGPAP
GTFHHGLSHSLLAGLHSSPPHTAPLPHAAVSTHVPQSLPDASQLHGKGPVVPRKL
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgtcggagccccacagggtccagttcacctctgtcccaggttctttgaatcctgcattt
ttgaagaagtccaggaaagaggaagttggaggaacagaacagcatcaagactgtgagcca
gctgcagcagctgttcggattacactcactctctttgaaccagatcacaaacggtgtcca
gagttcttctacccagagttggtaaagaatatccgcgggaaggtaaaaggccttcatcct
ggagacaagaaaaaagatgtcttggatcctttcaatgatgaagaaaaagaaaggcataag
gtggaggcccttgcacggaaatttgaagaaaaatatggtggaaagaaacgtaggaaagac
cgaatacaggacttgattgatatggggtatggctatgatgaatcggattctttcatcgat
aactctgaggcgtatgatgaacttgttcctgcttctttgactacaaagtatggaggattt
tacatcaactcaggaaccttgcagtttagacaagcttcagaatctgaagatgacttcatt
aaagaaaagaagaaaaaatctccgaagaagcggaagttgaaggaaggtggtgaaaagata
aaaaagaagaaaaaagatgacacttacgacaaggagaagaaatcgaaaaagtccaagttt
tccaaagccggcttcacagccctcaatgccagtaaggagaaaaagaagaagaagtactct
gggtcattaagcgttagagagatgctcaagaaatttcagaaggagaaagaggctcagaaa
aaaagggaggaggagcataaacctgtagctgtgtcatcaatagaagctcagggccttagg
gaactggagggcacttctgacccactgctctcactctttggctctacttctgacaatgac
ttgctccaagctgccactgccatggactctctgacggatttggacttggagcagttgctc
agtgagtctccagaaggaagccctttccgagatatggatgatggaagtgattcccttggg
gtgggattggatcaggaattcaggcagccctcttccttccccgaaggcctgccgataccc
ctggagaagcgtgttaaggagctggctcaggctgccagagctgctgagggagagagcaaa
cagaaattcttcactcaagatattaatggcatcctgctggacatagaggtgcaaactcgg
gagctgactagccaaatccgttctggggtgtttgcctatctggcttcattcctgccctgc
agcaaggatgctctagtcaagcgtgctcggaaacttcacctctacgaacagggtgggcgc
ctgaaagagccactccagaagctcaaggatgccataggtagggctatgcctgagcaggta
gccaagtaccaggatgaatgccaagcacacacacaggcaaaggttgctaagatgctggag
gaagagaaagacaaggagcagagagaacggatttgttctgatgaagaagaggatgaagaa
aaggggggccggagaataatggggccccggaagaaattccagtggaatgatgaaatcagg
gagcttctgtgccaggtggtgaagatcaagctggagagccgtgatctggagaggaacagc
aaggcccaggcctgggaggactgtgtgaaagcttttctggatgctgaggtcaagcctctc
tggcccaaaggctggatgcaagccaggactctatttaaggagagccgacgaggccatgga
cacctgacatcacttctggccaagaagaaagtaatagctccctcaaaaatcaagatgaag
gaatcatctgttaagcttgacaaaaaagtttctgttccatcaggacagcatggtggtccc
actactttgctctcagaacatcagggcggaggcctgaacactggggcaaacagcagggag
catccatcccaggcaacttgtggcctcactgactctgtttctgtcaccctggaggactcc
ctggatgaagacctcgtcaggaatccagcctcctctgttgatgctgtgtctaaggagctg
gctacgttgaacagcagagcagccaacagttccgaattcacactgcctacaccctccaaa
gcaccaacagaaaaagttggtggtgttttgtgtacagaagagaaacggaactttgcaaag
cccagctcttctgcaccaccccccacaaatgctctgcaatcacctctcaattttctggct
gagcaggctctagcactggggcagtcctctcaggagaaaaagccagagggttctggcttc
aaagagctatcctgtcagggtccccttagcaagggtgtgcctgaattacacccgtccaaa
gcaaagcaccacaatttgccacggacgtctcatggaccccaggcagcagctcctgtgcct
ggaccccaagtcaaagtctttcatgcaggcactcaacagcagaaaagcttcacaccccca
tccccatttgtcaacaagctgcaaggcccaaaggccacctctccacagtgtcatcggtcc
cttctgcagctggtaaagacagcagccaaaggccaggcattccatgccactatgccagcc
tcctctggaagttcaccagcctccagcagcagtgcccataagacgacagcctcaaactct
accaccatcagccatccagccaagctgcaccccaccagctctgtggggccgtcttataag
aataaccccttcgctggctcagtctctaaacatggggcttcttctagcagcccatcgccc
ggaggaggagcccaagtgcagagctctgtttctggggcctcgctcccgggggtgcagtct
ccctcagcaggacagtctgctagccgagctgccccaagttctgctgtgaaaaaaacacct
gttactcagaagctgacccttgtagctccacctggaggtccaaatggagattctggtggt
gggacccagggagtggcaaaattactgacttcctccctgaagcctgctgcagttagtagt
gtgacatcgtctacctccttgccaaaaggaactggcggggcagtgctgctgtccaacacc
tcttccttaagcctgctgtcttcatcctataagtccaacaaccccaagcttccaggggct
atgaactcaaactcactgggaatcataacccaatttccacttcatgtactctccttcaat
gcagactcctctgccaaagcaggagtctctaaggatgccattgtcacaggtccagcccct
gggaccttccaccatggcctcagccacagtcttctggctggtttgcactccagcccaccc
cacacagcgcctctcccacatgctgctgtgtctacccatgtcccacagagcctgccagat
gcttcacagcttcatggtaaagggcctgttgtaccgaggaaattgtga

DBGET integrated database retrieval system