KEGG   Mus musculus (mouse): 170648Help
Entry
170648            CDS       T01002                                 

Gene name
Olfr138, MOR256-40P, Olfr89
Definition
(RefSeq) olfactory receptor 138
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    170648 (Olfr138)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    170648 (Olfr138)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    170648 (Olfr138)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx Herpes_U15
Motif
Other DBs
NCBI-GeneID: 170648
NCBI-ProteinID: NP_570938
MGI: 2177521
Ensembl: ENSMUSG00000057443
Vega: OTTMUSG00000037362
UniProt: Q7TRI7
Position
17; 17 B1
AA seq 312 aa AA seqDB search
MAVTNESHPKEFILLGFANHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLYSPMY
FFLKNLSFLDMCYTTSIVPQMLFNLGSSRKTITYIGCVVQLYVFHIMGGTECLLLAIMSF
DRYVAICKPLHYTLIMNQRVCILSVSIMWLTGVIFGFSEATLTLQLPLCGTNKLDHLLCE
IPVLIKTACGEKEFNELALSVVCIFILIVPLCLILASYVNIGCAVLRIKSSEGRRKAFGT
CSSHLIVVSLFYGPGISMYLQPSSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGA
FKKLLRSIFSSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaatgaaagccacccaaaagaattcatcctactgggctttgctaaccat
ccttggctggaactccctctctttgttactcttctgataacatatcccatggctttgatg
gggaacatcgccatcattctggtgtccaccttagaccctcgtctctacagccccatgtac
tttttcctcaagaatctctcctttctggacatgtgctacaccacaagcattgtgcctcag
atgctgtttaacctgggaagctccagaaaaaccattacttacattggatgtgttgttcaa
ctttatgtcttccacataatgggaggcacagaatgtctacttttagctattatgtccttt
gatcgatatgtggctatctgcaaacctctccactacactctcattatgaaccaaagagta
tgcattttgtcagtatctattatgtggctgactggagtgatctttggtttttcagaggct
acacttacattgcaactgccattatgtggcacaaataaattggatcatttattgtgtgaa
atcccagttctcataaaaactgcctgtggtgaaaaggaatttaatgagctagcactttct
gtggtatgcatttttatacttattgttcctctgtgcttaattcttgcttcttatgttaat
attggatgtgcagtacttagaattaaatcttctgaaggaaggaggaaagcctttgggaca
tgttcttcccatctcattgtagtttccttattttatggtccaggtattagcatgtacctt
cagccttcttcatctatcacaagggaccaacccaagttcatggctctgttttatgcggtg
ataactcctacattgaatcccttcatctataccctaagaaacaaggatgtaaagggtgcc
tttaaaaagctcctgagaagcattttcagttcaaagtga

DBGET integrated database retrieval system