KEGG   Mus musculus (house mouse): 170719
Entry
170719            CDS       T01002                                 
Symbol
Oxr1, 2210416C20Rik, C7, C7B
Name
(RefSeq) oxidation resistance 1
  KO
K25437  oxidation resistance protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    170719 (Oxr1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    170719 (Oxr1)
SSDB
Motif
Pfam: TLD LysM GRAM
Other DBs
NCBI-GeneID: 170719
NCBI-ProteinID: NP_001123638
MGI: 2179326
Ensembl: ENSMUSG00000022307
UniProt: Q4KMM3
Position
15:41310745..41724447
AA seq 866 aa
MSVSNLSWLKKKSQSVDITAPGFNPLGGAGKQAPQASKPPAPKTPIIEEEQNNSANTQKH
PSRKSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTTPDVA
HPKEAPPASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNI
MFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCH
SKKATGVSAEDADPRARDQGNDSASTAPRSTEESLSEDAFTESELSPIREELLSSEPRQE
KSSDASSESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGLSGLETATKGGDKA
TESLQEVSGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQ
GQELKRDSETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLK
EKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFI
QWSPEIYAEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEVVSVAEYHRRIDALN
TEELRTLCRRLQITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKLTKHLP
PRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDG
FYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHS
CKTFGNHTLSKKEDFFIQDIEIWAFE
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgtctgtatctaatctatcatggttgaagaaaaagtcccagtcagtggatattactgct
ccagggttcaaccctttaggtggtgcagggaagcaagcaccacaagccagcaagcccccg
gcacccaagacccccatcatcgaagaagaacagaacaactcagcaaacacccagaagcat
ccttccagaaaaagtgaactgaagaggttctataccattgacactggccaaaagaagacc
ttagacaagaaagatgggagaaggatgtcttttcagaagcctaaaggaaccattgaatat
actgttgaatcaagggattctttgaatagcatagccctgaaatttgataccacacccaat
gaacttgttcagttaaataagttattctctcgagcagtcgtgactggacaggttttatac
gttcctgatcctgaatatgtctctagtgttgagagttccccatccctcagccctgtaagc
cctctgtcgccaacgtcatccgaggctgaatttgataaaaccacgactccagatgtagcc
catccaaaagaagcacccccggcatcgactgtgagcggtattcggcctgcgagagttgtg
tcttcaacttctgaagaagaagaagcctttactgagaaatttcttaaaattaattgcaaa
tatatcaccattggcaagggcacagtcagtggcgtcctgctagtcacaccaaataacata
atgtttgatccacacaagacagaccccttggttcaagagaacggttgtgaggaatacggc
atcatgtgtccgatggaagaggtgatgtcagctgccatgtacaaagagattttggatagc
aaaataaaggaatcactgcccatagaactagatcagttgtcaggaagggggtcctgccat
tcaaagaaagcgacaggagtctctgctgaggacgcagacccgagagcgcgtgaccagggt
aacgacagtgccagcactgctcccaggagcaccgaggagtctctctcggaagacgctttc
acagagtcagaactctctcctatccgcgaggagctgctctcctcggagccgagacaggag
aagtcatctgatgcctcgtcagaatctgtgcagactgtcagtcagatggaagtccagtcc
ttgacagccacgtcagaggctgctaacgttcctgaccgcactagctctaaccctggggct
ctatctcatgaaactggcttaagtggtctggaaacagccactaaaggaggagataaagct
acagaaagccttcaagaagtctcaggcccaaaggaacaaagcacagaagtaaaaggtcag
gataaccaggattcttcccaccaggaaagttcactgcagcaagaggcaggtgaagacagt
gtatcttctggagaaacagtagaactgaaagaaaaaccagctgttcttaaggatcaacaa
gggcaggagctaaaacgggactcagagacagaagtagaggagctgcgcaaactctggaaa
actcactctatgcagcaagccaagcagcaaagggacacgattcagcaggtgtcacagaga
gaaagtaaacacagcagcgcagcagcagacgcacatggagagggctcctcgctgttaaag
gaaaagcgaaggcatcgattacataagttcctatgtctcagagtcggaaaaccaatgagg
aagacctttgtatcgcaagcaagtgctacgatgcaacagtatgcacaaagagataaaaaa
cacgaatattggtttgcagtgccacaagaaaggacagaccacttgtatgccttcttcatt
cagtggagtccagaaatctatgcagaagattctggtgaatacaccagagagcctggattc
atagtagtcaaaaagatggacgagtctgaagcgaatgaagcccctgctggtgaagcagca
gccagggagtgggaggtagtgtcggtggctgagtatcaccgcaggatcgatgctctaaat
actgaagaactgcgcacactctgcagacggctccagattactacaagggaagacatcaac
tcaaagcaggttgctccagcaaaagcagacctggagcctgaatctttccgaccaaaccta
agcgaccccagtgaactcttactgcctgatcagattgaaaagcttactaagcaccttcca
ccaagaaccattggctatccatggacgcttgtgtacggtactgggaagcatggtacaagt
ttgaagaccctttatcgaacaatgacaggtttagacactccggtgctgatggtgattaaa
gacagtgatggacaggtttttggtgcattagcatcagagccatttaaagtaagtgatggc
ttttacggtactggagaaacatttgttttcacattctgcccagaatttgaggtctttaag
tggacaggagataatatgttttttatcaaaggagacatggattcattagcatttggtggt
ggaggaggggaatttgctctttggcttgatggagatctctaccatggaagaagccattcc
tgtaaaacgtttgggaatcatacactttctaagaaggaagatttctttatccaagacatt
gaaatctgggcttttgaataa

DBGET integrated database retrieval system