KEGG   Mus musculus (house mouse): 170722
Entry
170722            CDS       T01002                                 
Symbol
Nxf7, Nx7, Nxf6, nfx-a1, nxf-a, nxf-a2
Name
(RefSeq) nuclear RNA export factor 7
  KO
K14284  nuclear RNA export factor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu03013  Nucleocytoplasmic transport
mmu03015  mRNA surveillance pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    170722 (Nxf7)
   03015 mRNA surveillance pathway
    170722 (Nxf7)
   03008 Ribosome biogenesis in eukaryotes
    170722 (Nxf7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    170722 (Nxf7)
   05168 Herpes simplex virus 1 infection
    170722 (Nxf7)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    170722 (Nxf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    170722 (Nxf7)
   03009 Ribosome biogenesis [BR:mmu03009]
    170722 (Nxf7)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     170722 (Nxf7)
   mRNA cycle factors
    Stress granule specific factors
     170722 (Nxf7)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    170722 (Nxf7)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_8 LRR_4
Other DBs
NCBI-GeneID: 170722
NCBI-ProteinID: NP_001366606
MGI: 2159343
Ensembl: ENSMUSG00000031410
Position
X:complement(134480304..134499530)
AA seq 610 aa
MCSNERKQGSFRYTGRKKDRVSSLSYAGKRTDHYEHTGHTILPFKAQSDGGNLEMRAVLW
NPSVRHTPYVGQHRSREEEHMEDQIHVTAQRDDKPEQREAGQFTEDGELGSWFKVTVPCG
RKYDKTQLMNSIHSLCSVPFTPVDFHCDKHRIQFFVPDFRIASALKDISYKIHNEYFQKI
PIFVNPSVAPYSVQNRFTKEEMEQLKLAMRKRYDVSQHALCLKKLRFDPDLMKNNIHMIL
NHRSCMAATLQIIQENFPKLLSLNLSSNKLFQLDSLIDVVKKAPQLKILNLSKNMLRTVW
ELEKMKGLKLEQLWLEGNPLCSTFPDRSSYIRAVLECFPELSYLDGRKLLLPTVMNTQER
KLMKPCKDIFMGSEVIKNQVHRFLREYYLMYDSEERQGLLNIYHDQACFSLTIPFNPNDP
DLNSMYVYFKDENDMKNFKEFHIQRQLLKYTKQDIVECLRGFPQTLHAFSSFQVNICFQM
ETMLCFSVCGLFKEEGTPKECVRAFMRIFIALLGSSNMYIVNDQLFVRNPSSEEINSAFV
IPSPTSYSNFKLVLSQEQQRMVQAFSTQSGMKLEWSQKCLEDNKWDYARAAEVFTMLQTK
CKIPKEFFKQ
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgtgctctaatgaaaggaagcaggggtccttcagatacacaggaagaaagaaagacagg
gtttcttccctgagctatgctggcaagaggaccgatcattatgagcatactgggcacacg
attctgcctttcaaagcccagagtgatggtggaaatctggagatgagagctgttctctgg
aacccgtcagtaagacacacaccttatgttgggcaacataggagtagggaggaagagcat
atggaagaccaaatccatgtcacggcgcagagagatgacaaacctgaacagagagaagca
gggcagttcacagaagacggagaactggggagctggttcaaggtcacggttccatgtggg
aggaagtatgacaagacacagctaatgaattcaatccacagcctttgcagcgtgcccttc
acacctgtggatttccattgtgacaaacaccggatccagttctttgtcccagactttcgc
attgcctctgcattgaaggatatcagctataagatacataatgagtactttcagaagatt
cctatttttgtcaatccctcggttgcaccctactctgtgcagaatagattcacaaaagaa
gaaatggaacagctgaagctggccatgaggaaaagatatgatgtttcccagcatgctctc
tgcctcaaaaagctccgctttgatccagacttgatgaaaaacaacatccacatgatccta
aatcacagaagctgcatggctgccacccttcagatcatccaagagaattttcctaagctg
ttatccttgaacttgagcagcaacaaactgttccaattagatagcctgattgatgtggta
aagaaggcaccgcaactcaagatcttgaacctctccaaaaacatgctaagaacagtgtgg
gagttggagaagatgaaagggctgaagctggagcagctgtggctagaagggaacccattg
tgcagcaccttcccagaccgatcttcctatataagagcagtcctggaatgttttccggag
ttgtcatacctggatggcaggaagttattacttccaactgtaatgaacactcaagaacgc
aagttaatgaagccctgcaaggacatctttatgggttcagaggtgataaagaatcaagta
cacagattcctgcgagagtattacttgatgtacgactctgaagagcgacagggtctcctg
aacatttaccatgaccaggcctgcttctccctgaccattcccttcaaccccaatgatcca
gatctgaatagcatgtatgtctacttcaaggatgaaaatgatatgaagaatttcaaggag
ttccacattcagaggcagctactgaagtacacaaaacaagatattgtggagtgtctgagg
ggatttccccaaactctacatgccttcagctctttccaagtgaacatctgttttcagatg
gaaacgatgctctgcttctctgtttgtgggttgttcaaggaagagggcacccccaaggaa
tgtgttcgtgcctttatgaggatcttcattgctctccttggcagttcaaacatgtatatt
gtgaatgaccagctttttgtgaggaatccaagctctgaagagatcaatagtgcctttgtc
ataccctcgcccacatcatactccaacttcaagcttgtcctttctcaagagcagcaaaga
atggtgcaggctttctccacccagtcggggatgaaacttgaatggtctcagaagtgcctt
gaagataacaagtgggactatgccagagctgctgaagtcttcactatgcttcagaccaag
tgcaagatcccaaaggaattcttcaaacaatga

DBGET integrated database retrieval system