KEGG   Mus musculus (mouse): 170732
Entry
170732            CDS       T01002                                 

Gene name
Trhr2, TRH-, TRH-R2
Definition
(RefSeq) thyrotropin releasing hormone receptor 2
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    170732 (Trhr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    170732 (Trhr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    170732 (Trhr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    170732 (Trhr2)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw TAS2R
Other DBs
NCBI-GeneID: 170732
NCBI-ProteinID: NP_573465
MGI: 2177284
Ensembl: ENSMUSG00000039079
Vega: OTTMUSG00000027550
UniProt: Q9ERT2
Position
8; 8 E1
AA seq 382 aa
MDGPSNVSLVHGDTTLGLPEYKVVSVLLVLLVCTVGIVGNAMVVLVVLTSRDMHTPTNCY
LVSLALADLIVLLAAGLPNVSDSLVGHWIYGHAGCLGITYFQYLGINVSSCSILAFTVER
YIAICHPMRAQTVCTVARARRIIAGIWGVTSLYCLLWFFLVDLNVRDNQRLECGYKVSRG
LYLPIYLLDFAVFFIAPLLGTLVLYGFIGRILFQSPLSQEAWQKERQSHGQSEGTPGNCS
RSKSSMSSRKQATRMLAVIVLLFAVLWTPYRTLVLLNSFLARPFLDPWVLLFCRTCVYTN
SAINPVIYSLMSQKFRAAFLKLCWCRAAGSQRRAACAPTSNYSAAQETSLGTEKMQLGSR
EVSGPAAAASLRCQHEPHFSVL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggatggtcccagcaatgtctcactcgttcacggtgacaccacactgggcctcccagag
tacaaagtagtctcggtcctcctggtcctcctggtgtgcaccgtgggcatcgtgggcaat
gccatggtggtcctggtggtgctgacctcacgtgacatgcacacacccaccaactgctac
ctggtcagcctggctctcgctgacctcattgtgctgctggctgcggggctgcccaatgtc
tctgacagcctggtggggcactggatctatggacatgctggctgcttgggcatcacctac
ttccagtacctaggcatcaatgtctcctcctgctccatcctggccttcactgtggagagg
tacatcgccatttgccacccaatgagagcacagaccgtgtgcactgtggcccgggccaga
cggatcatcgcaggcatttggggggtcacgtccctctattgcttactctggttctttctg
gtggacctcaatgtccgtgacaaccagcgcctggaatgtggctacaaggtgtcccgaggc
ctctacctgcccatctacctgctggactttgctgtcttcttcattgcacccttgctgggg
accctcgtgctctatgggttcattggaaggatcttatttcagagcccattgtcccaggag
gcctggcagaaggagaggcagtcccatgggcagagcgagggtacaccaggcaactgctct
aggtccaagagctcaatgtcctccaggaagcaggccaccaggatgctggccgtgattgtg
ttgctctttgcagtgctctggaccccctaccgcacactggtgctgctcaactccttcctg
gcccggcctttcctggacccctgggtcctgctgttctgccgcacctgcgtctacaccaac
agtgccatcaaccctgtcatctacagcctcatgtcgcagaaattccgggcagccttcctg
aaactgtgctggtgccgggcagctgggtcccagagacgtgcagcatgcgcccccaccagc
aactacagtgctgcccaggagacctccctaggaactgagaagatgcaactgggctcccgt
gaggtctcaggtccagcagcagctgcttccctgcgttgccagcatgagccccacttcagt
gtgctctga

DBGET integrated database retrieval system