KEGG   Mus musculus (mouse): 170736
Entry
170736            CDS       T01002                                 

Gene name
Parvb, AI595373, AW742462, D15Gsk, D15Gsk1, aff, affixin
Definition
(RefSeq) parvin, beta
  KO
K06275  parvin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170736 (Parvb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    170736 (Parvb)
   04147 Exosome [BR:mmu04147]
    170736 (Parvb)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     170736 (Parvb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   170736 (Parvb)
SSDB
Motif
Pfam: CH CAMSAP_CH CH_2 4HBT
Other DBs
NCBI-GeneID: 170736
NCBI-ProteinID: NP_573395
MGI: 2153063
Ensembl: ENSMUSG00000022438
Vega: OTTMUSG00000026115
UniProt: Q9ES46 Q3UGT9
Position
15; 15 E2
AA seq 365 aa
MSSAPPRSPTPRAPKMKKDESFLGKLGGTLARKKKTREVTDLQEEGKSAINSPMAPALVD
IHPEDTQLEENEERTMIDPTSREDPKFKELVKVLLDWINDVLAEERIIVKQLEEDLYDGQ
VLQKLLEKLAHCKLNVAEVTQSEIGQKQKLQTVLEAVQDLLRPHGWPLRWNVDSIHGKNL
VAILHLLVSLAMHFRAPIHLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEIMMGRFER
DAFDTLFDHAPDKLNLVKKSLITFVNKHLNKLNLEVTDLETQFADGVYLVLLLGLLEDYF
VPLHNFYLTPDSFDQKVHNVAFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYTLFTK
YKDVE
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcctccgcgccaccacggtcgcccaccccgcgggcccccaagatgaagaaggacgag
tctttcttgggcaagttgggcggcacactggcaaggaagaagaagaccagggaggtgact
gacttacaggaagaaggcaagagcgccatcaactctccaatggccccggctttggtggac
attcaccctgaagacacccagctagaggagaatgaggagcgtaccatgatcgatcccacc
tctagagaagaccccaagttcaaggagttggtcaaggtacttctggactggatcaacgat
gtgctggcagaggagcgcatcattgtgaagcagctggaggaggacctgtacgatggccag
gtgctccagaaacttctggaaaagctggcgcactgcaagctgaatgtggcagaggtgacg
cagtccgagatcgggcagaagcagaagttgcagacggttctggaagccgtgcaagacctg
cttcggccccatggctggccgctgcgttggaatgtggactctatccatgggaagaaccta
gtggccattctgcatctcctcgtctccctggccatgcacttcagggcccccattcacctt
cctgagcatgtcaccgtgcaggtggtggtcgttcggaagcgagaaggcttgctgcactcc
agccacatctcagaggagctgaccacgaccacagagatcatgatgggccggtttgagcgg
gacgccttcgatactcttttcgaccacgccccggacaagctcaaccttgtgaagaagtct
ctcatcacgtttgtgaacaaacacctgaataagctaaacttggaggtgactgacctggag
acccagtttgcagatggtgtgtacctagttctacttctgggccttcttgaagactacttt
gtcccccttcacaacttctacctgactcctgacagctttgaccagaaggtgcacaacgtg
gcctttgcctttgaactgatgctggatggaggcctcaagaagcccaaggcacgccctgaa
gatgtggtgaacttggacctcaagtccactctgcgggtcctttacacgctgttcaccaag
tacaaggatgtggagtga

KEGG   Mus musculus (mouse): 57342
Entry
57342             CDS       T01002                                 

Gene name
Parva, 2010012A22Rik, 5430400F08Rik, AI225929, AU042898, Actp, CH-IL, CH-ILKBP, Parvin, act
Definition
(RefSeq) parvin, alpha
  KO
K06275  parvin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    57342 (Parva)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    57342 (Parva)
   04147 Exosome [BR:mmu04147]
    57342 (Parva)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     57342 (Parva)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57342 (Parva)
SSDB
Motif
Pfam: CH CAMSAP_CH CH_2 FlaG
Other DBs
NCBI-GeneID: 57342
NCBI-ProteinID: NP_065631
MGI: 1931144
Ensembl: ENSMUSG00000030770
Vega: OTTMUSG00000024812
UniProt: Q9EPC1
Position
7; 7 F1
AA seq 372 aa
MATSPQKSPLVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSEFQEEGMNAINLP
LSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVD
SVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRV
LYNLFTKYRNVE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggccacatccccacagaagtcgcccttggtccccaaatcacccactcccaagtcgcct
ccgtcccgcaagaaggatgactcgttcttggggaaactcggagggacgctggcccggagg
aagaaagccaaagaagtatccgagttccaggaggaaggaatgaacgccatcaacctgcct
cttagccccatctccttcgagctggaccccgaggacactctgctggaggagaatgaggtc
cggacaatggtcgatccaaactcacgcaatgaccccaaacttcaagagctgatgaaggtg
ctcatcgactggatcaatgacgtattggtgggagaaagaatcatcgtgaaggacctcgct
gaagatctctatgatggccaagtcctacagaagctcttcgagaaactggagagtgagaag
ctcaacgtggccgaggttacgcagtcggagatcgcccagaaacagaagctacagactgtg
ctggagaagatcaatgagaccctgaagcttcctcccaggagcatcaagtggaacgtggac
tctgttcatgccaagaacctggttgccatcctccacctgctggttgctctgtctcaatat
ttccgggcacccatccgactcccagaccatgtttccatccaagtggttgtggtccagaaa
cgagaagggatcctccagtctcgacaaatccaagaggaaataactggtaacacagaggcc
ctttccggaaggcatgaacgtgatgcctttgacacgctgtttgaccatgcaccagacaaa
ctcaatgtggtgaagaagaccctcatcacgttcgtgaacaagcatctgaataaactgaac
ttggaggtcacagaactggagacacagtttgcagatggggtttacctggtgttgctcatg
gggctcctggaaggctactttgtacccctgcacagcttcttcctgaccccagacagcttt
gaacagaaggtcctgaatgtctcctttgcctttgagctcatgcaagatggagggctggaa
aagcctaaaccgcggccagaagacattgtcaactgtgacctgaagtccacgctgagagtg
ctatacaacctcttcaccaagtaccggaatgtggagtga

KEGG   Mus musculus (mouse): 64099
Entry
64099             CDS       T01002                                 

Gene name
Parvg, AI413459
Definition
(RefSeq) parvin, gamma
  KO
K06275  parvin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    64099 (Parvg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    64099 (Parvg)
   04147 Exosome [BR:mmu04147]
    64099 (Parvg)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     64099 (Parvg)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64099 (Parvg)
SSDB
Motif
Pfam: CH CAMSAP_CH
Other DBs
NCBI-GeneID: 64099
NCBI-ProteinID: NP_071716
MGI: 2158329
Ensembl: ENSMUSG00000022439
Vega: OTTMUSG00000026123
UniProt: Q9ERD8 Q8CEF2
Position
15; 15 E2
AA seq 331 aa
MELEFLYDLLQLPKEVAQPTEEELPRGGKKKYLSPNSKRNPKFEELQKVLMEWINTTLLP
EHIVVRSLEEDMFDGLILHHLFQKLASLKLEVEEISLTSASQRHKLGVILEAVNQNLQVE
EKQAKWSVETIFNKDLLATLHLLVALAKRFQPDLPLPDNVQVEVIHIESTKTGLKSDKQV
EQLTECKSHKDQPLQDAFDELFKLAPEKVHAVQEAIVSFVNQKLERLGLSVQSLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPSSPTEMLHNVTLALDLLKDEGLFSYPVNPEDIVNK
DAKSTLRILYSLFQKHSLRAEGGGAHHATPN
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagttagagttcctctatgacctgttgcagctcccaaaggaggtagctcagcccacg
gaggaagagcttccacgaggaggaaagaagaaatatctgtcacccaattccaagaggaac
cccaagtttgaagaactgcagaaggtgctgatggaatggatcaacaccacactcctcccg
gagcacatcgtggtccgcagcctggaggaagacatgtttgatggacttattctgcaccac
ctgttccagaagttggcatcgctcaagctggaagtggaggaaatctctctgacctcggcc
agccagaggcacaagctgggggtcatcctggaggccgtcaaccagaacctacaggtggaa
gagaagcaggccaagtggagcgtggagaccatcttcaacaaggacctgctggccaccttg
catctcctggtggccctggccaaacgcttccagccggacctgcccctcccagacaacgtc
caggtggaagtcatccacattgagagcaccaagaccggcctgaagtcggacaagcaggtg
gagcagctcacagaatgcaagtcacacaaggaccagcctttacaggacgcctttgatgaa
ttatttaagctggctccggagaaagtgcacgccgtccaagaggccattgtgagctttgtc
aaccagaagctagagcgcctgggcctgtctgtgcagagtctggatacccagtttgcagat
ggcgtcatcctgctcctgctgattggacaactggaaggcttcttcttgcatctgaaggaa
ttctatctcactcccagctctcccacagaaatgctgcacaatgtcaccctagccctggat
ctgctcaaggatgaaggcctgttcagctaccctgtcaaccctgaagatattgtgaacaag
gacgccaagagcacactgaggatactttacagcctattccagaagcattcactgagggcg
gagggtggaggggcacaccatgctaccccaaactag

DBGET integrated database retrieval system