KEGG   Mus musculus (house mouse): 170737
Entry
170737            CDS       T01002                                 
Symbol
Znrf1, B830022L21Rik, Rnf42, Zrfp1, nin283
Name
(RefSeq) zinc and ring finger 1
  KO
K10694  E3 ubiquitin-protein ligase ZNRF1/2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    170737 (Znrf1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     170737 (Znrf1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    170737 (Znrf1)
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4_2 zf-RING_11 zf-RING_16 zf-RING_UBOX zf-rbx1 zf-C3HC4 zf-C3HC4_3 zf-RING_5 zf-RING-like zf_UBZ zf-Di19 RNF220 PRP21_like_P RINGv
Other DBs
NCBI-GeneID: 170737
NCBI-ProteinID: NP_001162092
MGI: 2177308
Ensembl: ENSMUSG00000033545
UniProt: Q91V17
Position
8:112262652..112352352
AA seq 227 aa
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMD
PSTAGGVPFSLYTPASRGTGDSERAPGGGGSTSDSTYAHGNGYQETGGGHHRDGMLYLGS
RASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKD
AGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
NT seq 684 nt   +upstreamnt  +downstreamnt
atggggggcaagcagagcacggcggcccgctctcggggccccttcccgggggtctctacg
gatgacagcgccgtgccgccgccgggaggggcgccccactttgggcactaccggacgggc
ggcggggcgatggggctgcgcagccgctcggtcagctcggtggcgggcatgggcatggac
cccagcacggccggaggggtgccctttagtctctacacccccgcctcccgcgggaccggc
gactccgagagggcgccgggcggcggagggtccacgtcggactccacctatgcccacggc
aatggttaccaagagaccggcggcggtcaccatagagacgggatgctgtacctgggctcc
cgagcctcgctggcggatgctctacctctgcacatcgcacccaggtggttcagctcgcac
agtggtttcaagtgccccatttgttccaagtctgtggcttccgatgagatggaaatgcac
tttataatgtgtctgagcaagcctcgcctgtcctacaatgatgatgtgctgactaaagat
gcgggtgagtgtgtgatctgcctggaggagctgcttcagggggacacgatagccaggctg
ccttgcctgtgcatctatcacaaaagctgcatagactcatggtttgaagtgaacagatct
tgtccagagcaccctgctgactga

DBGET integrated database retrieval system