KEGG   Mus musculus (mouse): 170738
Entry
170738            CDS       T01002                                 

Symbol
Kcnh7, 9330137I11Rik, Kv11.3, erg3
Name
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 7
  KO
K04910  potassium voltage-gated channel Eag-related subfamily H member 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    170738 (Kcnh7)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   170738 (Kcnh7)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS_3 PAS PAS_4 PAS_8 ATG16
Other DBs
NCBI-GeneID: 170738
NCBI-ProteinID: NP_573470
MGI: 2159566
Ensembl: ENSMUSG00000059742
Vega: OTTMUSG00000012800
UniProt: Q9ER47
Position
2; 2 C1.3
AA seq 1195 aa
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDEENAATPERVNPILPVKTVNRKLFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSQCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLTHSRSRESLCSIRRASSVHDIEGFSVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIA
PKVKERTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGTQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKSQSVNDSEGDTGKLRRRRLSFESEGEKDF
SKENSANDADDSTDTIRRYQSSKKHFEERKSRSSSFISSIDDEQKPLFLGTVDSTPRMVK
ATRLHGEETMPHSGRIHTEKRSHSCRDITDTHSWEREPARAQPEECSPSGLQRAAWGVSE
TESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQAILQLLQKQTTVVPPAYSMVTAGAEYQ
RPILRLLRTSHPRASIKTDRSFSPSSQCPEFLDLEKSKLQSKESLSSGRRLNTASEDNLT
SLLKQDSDASSELDPRQRKTYLHPIRHPSLPDSSLSTVGILGLHRHVSDPGLPGK
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgcctgttcgcagggggcatgtggcaccgcaaaacaccttcctggggaccatcatacgg
aaatttgaagggcagaataaaaaatttatcattgcaaatgccagagtgcagaactgtgct
atcatctactgcaatgatggcttctgtgagatgacgggtttctccaggccagatgtcatg
cagaagccgtgtacctgtgactttctccatgggcctgagaccaagaggcatgatattgcc
cagattgcccaggcgctgctggggtcagaggagaggaaagtggaggtcacctactatcac
aagaatggttccacttttatttgtaacactcacataatcccagtaaagaaccaagagggt
gtggctatgatgttcatcattaattttgagtatgtgacagatgaagaaaatgctgccact
ccagagagggtcaacccgatattaccagtcaagactgtaaaccggaaactttttgggttc
aaatttcctggactgagagttctaacatacagaaaacagtccttgccacaggaagacccg
gatgtggtagttattgattcttctaaacacagcgatgactctgtggccatgaagcacttt
aagtctcccacgaaagaaagttgcagtccctctgaagcagatgatacgaaagccttgata
cagcctagccagtgttctcccttagtgaacatatcaggacctctggaccattcctctccc
aaaagacaatgggaccgcctctaccctgacatgctgcagtcaagttcccaactaacacac
tccaggtcaagggagagcctctgtagcatacggagggcatcttcagttcatgatatagaa
gggttcagtgtccaccccaagaacatatttagagatcgacatgccagtgaagacaatggt
cgaaatgtcaaaggaccttttaatcatatcaagtcaagcctgctgggatccacatcagat
tcaaacctcaataagtacagcaccattaacaagatcccacaactcactctgaatttctca
gatgtcaaaacagaaaagaagaatacatcccctccttcttcagacaaaactattattgca
cccaaggttaaagaaaggacacacaacgtgaccgagaaagtaacccaggttctttctttg
ggagcagatgtcttgccagaatataagctgcagacgccacgcatcaacaaatttacaata
ttgcactacagtcctttcaaagcagtctgggattggcttattttactcttggtcatttat
actgctatattcaccccctactctgcagcatttctcctcaatgacagagaggaacagaaa
aggcgagaatgtggctattcttgtagccctttgaatgtggtagacttgattgtggatatt
atgtttattatagacattctaataaacttcagaacaacctatgtaaatcagaatgaagaa
gtggtaagtgatcctgccaaaatagcaatacactacttcaaaggctggttcctgattgac
atggttgcagccattccttttgacttgctgatttttggatcaggttctgatgagacaacg
acactaattggtcttttgaagactgcacgactcctgcgtcttgtgcgcgtagccaggaaa
ctggaccgatactcagaatatggtgcggctgttctaatgctcttgatgtgcatatttgcc
ctgattgcccactggctggcttgcatctggtatgcgattgggaatgtagagaggccctat
ctgactgacaaaattggatggttggattccttaggaacacaaattgggaaacgttacaat
gacagtgactcgagttctggaccgtccattaaagacaaatacgtcacggcactttatttt
accttcagcagtctaaccagtgtaggatttggaaatgtgtctcctaacaccaattcggag
aaaatcttttccatttgtgtcatgttgattggctctctaatgtatgcgagcatttttggg
aacgtttctgcaattattcaaagactgtactcaggaactgccaggtaccacatgcagatg
ctgagagtaaaagagttcattcgcttccaccaaatccccaaccctttgaggcaacggctt
gaggagtatttccagcatgcatggacttacactaacggcatagacatgaacatggtctta
aagggatttccagaatgtttacaagctgacatttgcctgcatctgaaccagactttgcta
caaaactgcaaagcctttcgaggagcaagtaaaggctgtcttagagctctggcaatgaag
ttcaaaaccacccatgcccctccaggagacaccctggttcactgtggggatgttctaact
gcactgtacttcttatccagaggctccattgaaatcctcaaggatgatatagtggtagct
attcttggaaaaaatgatatctttggggaaatggttcatctttatgccaaacctggcaag
tctaatgcagatgtgagagcacttacgtactgtgacctgcataagattcagcgagaagat
ttattagaggtcttggatatgtatccagaattttctgatcactttctgacaaatctagaa
ctgactttcaacctgagacatgaaagtgccaagtcccaatctgtaaatgattctgaagga
gacaccggtaaacttcggagaaggcgattgtcctttgaaagtgaaggggaaaaagatttt
agcaaagaaaacagtgcaaatgacgctgacgactctacagatacaataaggcgttaccag
agttccaagaagcacttcgaagagaggaaaagcagatcgtcatcgttcatctcctccatt
gatgatgagcaaaagccactcttcttaggaacagtagattctactccaagaatggtgaaa
gcaaccagactccatggtgaagaaacaatgccacactcaggaagaattcacacagaaaaa
aggagtcactcctgcagagatatcactgatacacacagctgggaaagagagcctgcccgg
gctcaacctgaagaatgtagtccctcaggacttcagagagctgcctggggcgtctctgag
acggaaagcgacctcacctatggggaagtggagcaaagattagatttacttcaagagcaa
cttaacagacttgaatcccaaatgacaacggacatccaggccatcttgcagctcctgcag
aaacaaaccacggtagtccctccagcctacagcatggtgactgcaggagcagagtaccag
aggcccatcctccgtctgttgagaaccagtcaccccagagcatccattaagactgaccgg
agtttcagcccctcctcacagtgtcctgaatttctcgacctcgaaaaatccaaactccaa
tccaaagagtcactctcaagcggaaggcgcctgaacacagcttccgaagacaacttgact
tcccttttaaaacaagacagtgatgcgtcatcagagcttgaccctcggcaaaggaaaact
taccttcatcccatccggcatccctctctgccagactcctccctaagcactgtagggatc
ttgggtctccataggcatgtctctgaccctggtcttccagggaagtaa

DBGET integrated database retrieval system