KEGG   Mus musculus (mouse): 170743
Entry
170743            CDS       T01002                                 

Gene name
Tlr7
Definition
(RefSeq) toll-like receptor 7
  KO
K05404  toll-like receptor 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu05162  Measles
mmu05164  Influenza A
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    170743 (Tlr7)
   04620 Toll-like receptor signaling pathway
    170743 (Tlr7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    170743 (Tlr7)
   05164 Influenza A
    170743 (Tlr7)
   05162 Measles
    170743 (Tlr7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    170743 (Tlr7)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   170743 (Tlr7)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR LRR_5 LRR_1 LRR_12 TIR_2 LRR_9 LRR_6
Other DBs
NCBI-GeneID: 170743
NCBI-ProteinID: NP_001277684
MGI: 2176882
Ensembl: ENSMUSG00000044583
Vega: OTTMUSG00000019578
UniProt: P58681 Q548J0
Position
X; X F5
AA seq 1050 aa
MVFSMWTRKRQILIFLNMLLVSRVFGFRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIP
EGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRP
GSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLG
QNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKI
QENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSN
SLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFSFNYELQVYHASI
TLPHSLSSLENLKILRVKGYVFKELKNSSLSVLHKLPRLEVLDLGTNFIKIADLNIFKHF
ENLKLIDLSVNKISPSEESREVGFCPNAQTSVDRHGPQVLEALHYFRYDEYARSCRFKNK
EPPSFLPLNADCHIYGQTLDLSRNNIFFIKPSDFQHLSFLKCLNLSGNTIGQTLNGSELW
PLRELRYLDFSNNRLDLLYSTAFEELQSLEVLDLSSNSHYFQAEGITHMLNFTKKLRLLD
KLMMNDNDISTSASRTMESDSLRILEFRGNHLDVLWRAGDNRYLDFFKNLFNLEVLDISR
NSLNSLPPEVFEGMPPNLKNLSLAKNGLKSFFWDRLQLLKHLEILDLSHNQLTKVPERLA
NCSKSLTTLILKHNQIRQLTKYFLEDALQLRYLDISSNKIQVIQKTSFPENVLNNLEMLV
LHHNRFLCNCDAVWFVWWVNHTDVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTN
LILFSVSISSVLFLMVVMTTSHLFFWDMWYIYYFWKAKIKGYQHLQSMESCYDAFIVYDT
KNSAVTEWVLQELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTQ
KYAKTESFKMAFYLSHQRLLDEKVDVIILIFLEKPLQKSKFLQLRKRLCRSSVLEWPANP
QAHPYFWQCLKNALTTDNHVAYSQMFKETV
NT seq 3153 nt   +upstreamnt  +downstreamnt
atggtgttttcgatgtggacacggaagagacaaattttgatctttttaaatatgctctta
gtttctagagtctttgggtttcgatggtttcctaaaactctaccttgtgaagttaaagta
aatatcccagaggcccatgtgatcgtggactgcacagacaagcatttgacagaaatccct
gagggcattcccactaacaccaccaatcttacccttaccatcaaccacataccaagcatc
tctccagattccttccgtaggctgaaccatctggaagaaatcgatttaagatgcaattgt
gtacctgttctactggggtccaaagccaatgtgtgtaccaagaggctgcagattagacct
ggaagctttagtggactctctgacttaaaagccctttacctggatggaaaccaacttctg
gagataccacaggatctgccatccagcttacatcttctgagccttgaggctaacaacatc
ttctccatcacgaaggagaatctaacagaactggtcaacattgaaacactctacctgggt
caaaactgttattatcgaaatccttgcaatgtttcctattctattgaaaaagatgctttc
ctagttatgagaaatttgaaggttctctcactaaaagataacaatgtcacagctgtcccc
accactttgccacctaatttactagagctctatctttataacaatatcattaagaaaatc
caagaaaatgattttaataacctcaatgagttgcaagttcttgacctaagtggaaattgc
cctcgatgttataatgtcccatatccgtgtacaccgtgtgaaaataattcccccttacag
atccatgacaatgctttcaattcattgacagaattaaaagttttacgtttacacagtaat
tctcttcagcatgtgcccccaacatggtttaaaaacatgagaaacctccaggaactagac
ctctcccaaaactacttggccagagaaattgaggaggccaaatttttgcattttcttccc
aaccttgttgagttggatttttctttcaattatgagctgcaggtctaccatgcatctata
actttaccacattcactctcttcattggaaaacttgaaaattctgcgtgtcaaggggtat
gtctttaaagagctgaaaaactccagtctttctgtattgcacaagcttcccaggctggaa
gttcttgaccttggcactaacttcataaaaattgctgacctcaacatattcaaacatttt
gaaaacctcaaactcatagacctttcagtgaataagatatctccttcagaagagtcaaga
gaagttggcttttgtcctaatgctcaaacttctgtagaccgtcatgggccccaggtcctt
gaggccttacactatttccgatacgatgaatatgcacggagctgcaggttcaaaaacaaa
gagccaccttctttcttgcctttgaatgcagactgccacatatatgggcagaccttagac
ttaagtagaaataacatattttttattaaaccttctgattttcagcatctttcattcctc
aaatgcctcaacttatcaggaaacaccattggccaaactcttaatggcagtgaactctgg
ccgttgagagagttgcggtacttagacttctccaacaaccggcttgatttactctactca
acagcctttgaagagctccagagtcttgaagttctggatctaagtagtaacagccactat
tttcaagcagaaggaattactcacatgctaaactttaccaagaaattacggcttctggac
aaactcatgatgaatgataatgacatctctacttcggccagcaggaccatggaaagtgac
tctcttcgaattctggagttcagaggcaaccatttagatgttctatggagagccggtgat
aacagatacttggacttcttcaagaatttgttcaatttagaggtattagatatctccaga
aattccctgaattccttgcctcctgaggtttttgagggtatgccgccaaatctaaagaat
ctctccttggccaaaaatgggctcaaatctttcttttgggacagactccagttactgaag
catttggaaattttggacctcagccataaccagctgacaaaagtacctgagagattggcc
aactgttccaaaagtctcacaacactgattcttaagcataatcaaatcaggcaattgaca
aaatattttctagaagatgctttgcaattgcgctatctagacatcagttcaaataaaatc
caggtcattcagaagactagcttcccagaaaatgtcctcaacaatctggagatgttggtt
ttacatcacaatcgctttctttgcaactgtgatgctgtgtggtttgtctggtgggttaac
catacagatgttactattccatacctggccactgatgtgacttgtgtaggtccaggagca
cacaaaggtcaaagtgtcatatcccttgatctgtatacgtgtgagttagatctcacaaac
ctgattctgttctcagtttccatatcatcagtcctctttcttatggtagttatgacaaca
agtcacctctttttctgggatatgtggtacatttattatttttggaaagcaaagataaag
gggtatcagcatctgcaatccatggagtcttgttatgatgcttttattgtgtatgacact
aaaaactcagctgtgacagaatgggttttgcaggagctggtggcaaaattggaagatcca
agagaaaaacacttcaatttgtgtctagaagaaagagactggctaccaggacagccagtt
ctagaaaacctttcccagagcatacagctcagcaaaaagacagtgtttgtgatgacacag
aaatatgctaagactgagagttttaagatggcattttatttgtctcatcagaggctcctg
gatgaaaaagtggatgtgattatcttgatattcttggaaaagcctcttcagaagtctaag
tttcttcagctcaggaagagactctgcaggagctctgtccttgagtggcctgcaaatcca
caggctcacccatacttctggcagtgcctgaaaaatgccctgaccacagacaatcatgtg
gcttatagtcaaatgttcaaggaaacagtctag

DBGET integrated database retrieval system